DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7322 and dcxr

DIOPT Version :9

Sequence 1:NP_001259693.1 Gene:CG7322 / 32880 FlyBaseID:FBgn0030968 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_989100.1 Gene:dcxr / 394704 XenbaseID:XB-GENE-990326 Length:244 Species:Xenopus tropicalis


Alignment Length:243 Identity:118/243 - (48%)
Similarity:160/243 - (65%) Gaps:6/243 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWTDLAGKVILVTGAGAGIGQALVKQLASAGATVIAVARKPEQLQQLVAFDPVHIQPLQLDLSGW 65
            |..:..|:..||||||.|||:..||.|...||.|:|::|..|.|:.|....| .:|.:.:||:.|
 Frog     1 MEINFCGQRALVTGAGKGIGRETVKALRKTGAEVVALSRTFEDLESLAQECP-GVQTVCVDLADW 64

  Fly    66 QAVREGLAKVPLLDGLVNNAGVAIIKPFEELTEQDFDTHFDVNIKAVFNVTQ----SLLPRLKDG 126
            .|..:.|:.:..:|.|||||.||:::||..:||:.||..|.||:|||.:|:|    .::.|...|
 Frog    65 SATEKALSSIGPVDLLVNNAAVAVLQPFLAVTEEAFDKSFAVNVKAVLHVSQIVVHQMIERGVPG 129

  Fly   127 ASIVNVSSIASSRSFGGHTAYSATKAALDSLTKSLALELGPRKIRVNSVNPTVVLTKMGADNWSD 191
            | ||||||.||..:...|:.|.|||.|||.|||.:.|||||:||||||||||||:|:||...|||
 Frog   130 A-IVNVSSQASQCALQDHSVYCATKGALDMLTKVMTLELGPKKIRVNSVNPTVVMTEMGRIGWSD 193

  Fly   192 PAKSGPLLAHIPLNRFCEVQEVVDATGYLLSSKSSFVNGHHILLEGGY 239
            |.||.|:|..||:.||.||::||.:..:|||.|||.:.|..:.::||:
 Frog   194 PQKSEPMLKRIPMGRFAEVEDVVHSILFLLSDKSSMITGSCLPVDGGF 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7322NP_001259693.1 XR_like_SDR_c 1..242 CDD:187609 118/243 (49%)
dcxrNP_989100.1 XR_like_SDR_c 1..244 CDD:187609 118/243 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 195 1.000 Domainoid score I3095
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H22964
Inparanoid 1 1.050 195 1.000 Inparanoid score I3712
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051625at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - oto105478
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1266
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.