DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7322 and CG3699

DIOPT Version :9

Sequence 1:NP_001259693.1 Gene:CG7322 / 32880 FlyBaseID:FBgn0030968 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster


Alignment Length:253 Identity:92/253 - (36%)
Similarity:137/253 - (54%) Gaps:30/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LAGKVILVTGAGAGIGQALVKQLASAGATVIAVARKPEQLQQLVAFDPVHIQPLQLDLSGWQA-- 67
            |:.||::||||.:|||.|:.:.||..|||:..|.|           :..:::..:..|.|.||  
  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGR-----------NVANLEATKKSLKGTQAEI 56

  Fly    68 ------------VREGLAKVPLLDGLVNNAGVAIIKPFEELTEQDFDTHFDVNIKAVFNVTQSLL 120
                        |::.|||...:|.||||||:.......:|..::||...:.|::.|..:|:::|
  Fly    57 VVADVTKDADAIVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVL 121

  Fly   121 PR-LKDGASIVNVSSIASSRSFGGHTAYSATKAALDSLTKSLALELGPRKIRVNSVNPTVVLTKM 184
            |. ||...::|||||.|..|.|.|..:|..:|||||..||.:|||:.|:.:|||||||..|:|.:
  Fly   122 PHLLKTKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNI 186

  Fly   185 GAD-NWSDPAKSGPLLAHI---PLNRFCEVQEVVDATGYLLSSKSSFVNGHHILLEGG 238
            ..: ...|...:|.|...|   |:.|..:|.||.:|..:|.|||:||..|....::||
  Fly   187 HRNIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGG 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7322NP_001259693.1 XR_like_SDR_c 1..242 CDD:187609 92/253 (36%)
CG3699NP_569875.2 fabG 1..244 CDD:235546 90/251 (36%)
NADB_Rossmann 3..248 CDD:304358 92/253 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I1866
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I1506
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm46682
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.