DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7322 and SPAC922.06

DIOPT Version :9

Sequence 1:NP_001259693.1 Gene:CG7322 / 32880 FlyBaseID:FBgn0030968 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_595006.1 Gene:SPAC922.06 / 2543550 PomBaseID:SPAC922.06 Length:258 Species:Schizosaccharomyces pombe


Alignment Length:249 Identity:78/249 - (31%)
Similarity:124/249 - (49%) Gaps:33/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GKVILVTGAGAGIGQALVKQLASAGATVIAVARKPEQLQQLVAFDPVHIQ----PLQLDLSGWQA 67
            |:|:|:|||..|||:.|.|.....|..|..:        .:|  ||..:|    .||.|:|....
pombe     5 GRVVLITGAAGGIGKVLCKMFTELGDRVAGI--------DIV--DPSKVQDAALALQADVSKADQ 59

  Fly    68 VREGLAKV-----PLLDGLVNNAGVAIIKPFEELTEQDFDTHFDVNIKAVFNVTQSLLPRLK--- 124
            :...:.||     | :|.|:||||:|...|||:|:.:.:|....:.::..:...:.::|.:.   
pombe    60 IETAIEKVIQTLGP-IDVLINNAGLADDTPFEQLSHESWDHDVSLVLRGNYLTQRYVIPHMAKQG 123

  Fly   125 DGASIVNVSSIASSRSFGGHTAYSATKAALDSLTKSLALELGPRKIRVNSVNPTVVLTKMGADNW 189
            .|.||||:.|: :...:.|..||||.||.|::|||:||:..||..||||...|..:.:..    |
pombe   124 KGGSIVNIGSV-NGHIYLGSPAYSAAKAGLENLTKALAVRYGPLGIRVNVCAPGTIWSPA----W 183

  Fly   190 SDPAKSGP-----LLAHIPLNRFCEVQEVVDATGYLLSSKSSFVNGHHILLEGG 238
            .:..|..|     :....|:.|....::|..|..:|..||:||:.|..:.::||
pombe   184 DERFKKHPDVGDRMKRWYPVGRLGTPEDVARAVIFLADSKNSFITGTTLYVDGG 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7322NP_001259693.1 XR_like_SDR_c 1..242 CDD:187609 78/249 (31%)
SPAC922.06NP_595006.1 PRK07074 6..248 CDD:180823 77/248 (31%)
SDR_c 8..235 CDD:212491 74/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm47173
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.