DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7322 and SPCC663.09c

DIOPT Version :9

Sequence 1:NP_001259693.1 Gene:CG7322 / 32880 FlyBaseID:FBgn0030968 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_588270.1 Gene:SPCC663.09c / 2539052 PomBaseID:SPCC663.09c Length:253 Species:Schizosaccharomyces pombe


Alignment Length:228 Identity:71/228 - (31%)
Similarity:108/228 - (47%) Gaps:20/228 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KVILVTGAGAGIGQALVKQLAS-AGATVIAVARKPEQLQQLVAFDPVH--IQPLQLDLSGWQAVR 69
            ||..:.|...|||.:|||:|:| .|.||.|.|||||...:|..:...|  ::.::||::..|:..
pombe     6 KVYFIAGGNRGIGLSLVKELSSREGTTVFASARKPEAATELQEWSKSHPNVKTVELDVTSQQSAN 70

  Fly    70 E---GLAK-VPLLDGLVNNAGVA-IIKPFEELTEQDFDTHFDVNIKA---VFNVTQSLLPRLKDG 126
            |   .:|| |..:|.|..|:|:. ......|..|:.::.|:..|:..   ||.....||.:.|..
pombe    71 EAAQSVAKAVDGIDVLWLNSGICQSYYTVMEAPEEVWNAHYQTNVLGPIHVFKAFYPLLTKKKTR 135

  Fly   127 ASIVNVSSIASSRSF--GGHTAYSATKAALDSLTKSLALELGPRKIRVNSVNPTVVLTKMGADNW 189
            ..|...|...|...|  .|.:||..:|||::...|.|::||........|::|.||.|.|.||..
pombe   136 QVIFTSSECGSMGDFRATGFSAYGQSKAAINFTMKELSVELADEHFTFISIHPGVVKTDMNADAI 200

  Fly   190 SDPAKSGP-LLAH------IPLNRFCEVQEVVD 215
            ....::.| :|.:      ||......:.:|||
pombe   201 KKFTETSPEMLTYLKKVTIIPEESVSSMLKVVD 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7322NP_001259693.1 XR_like_SDR_c 1..242 CDD:187609 71/228 (31%)
SPCC663.09cNP_588270.1 adh_short 6..198 CDD:278532 62/191 (32%)
carb_red_sniffer_like_SDR_c 8..253 CDD:187586 69/226 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.