DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7322 and F25D1.5

DIOPT Version :9

Sequence 1:NP_001259693.1 Gene:CG7322 / 32880 FlyBaseID:FBgn0030968 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_505704.1 Gene:F25D1.5 / 184922 WormBaseID:WBGene00009110 Length:277 Species:Caenorhabditis elegans


Alignment Length:256 Identity:84/256 - (32%)
Similarity:127/256 - (49%) Gaps:24/256 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AGKVILVTGAGAGIGQALVKQLASAGATVIAVARKPEQLQQ-----LVAFDPVH-IQPLQLDL-- 62
            :||.:::||:..|||::.....|..||.|....|..::|::     |.|..|.. |..:..|:  
 Worm     5 SGKSVIITGSSNGIGRSAAVIFAKEGAQVTITGRNEDRLEETKQQILKAGVPAEKINAVVADVTE 69

  Fly    63 -SGW-QAVREGLAKVPLLDGLVNNAGVAIIKPFEELTEQDFDTH---FDVNIKAVFNVTQSLLPR 122
             ||. ..:...|||...:|.|||||| |.:......|:|..:.:   |.:|.:||..:||.....
 Worm    70 ASGQDDIINTTLAKFGKIDILVNNAG-ANLADGTANTDQPVELYQKTFKLNFQAVIEMTQKTKEH 133

  Fly   123 L-KDGASIVNVSSI-ASSRSFGGHTAYSATKAALDSLTKSLALELGPRKIRVNSVNPTVVLTK-M 184
            | |....||||||| |..::..|:..|:..|||||..|:..|::|....:|||||:|..|.|. |
 Worm   134 LIKTKGEIVNVSSIVAGPQAHSGYPYYACAKAALDQYTRCTAIDLIQHGVRVNSVSPGAVATGFM 198

  Fly   185 GA----DNWSDPAKS--GPLLAHIPLNRFCEVQEVVDATGYLLS-SKSSFVNGHHILLEGG 238
            ||    :..||...|  |.....||:....:.:|:.:...:|.. :.||::.|..|:.:||
 Worm   199 GAMGLPETASDKLYSFIGSRKECIPVGHCGKPEEIANIIVFLADRNLSSYIIGQSIVADGG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7322NP_001259693.1 XR_like_SDR_c 1..242 CDD:187609 84/256 (33%)
F25D1.5NP_505704.1 FabG 3..259 CDD:223959 82/254 (32%)
SDR_c11 4..263 CDD:187622 84/256 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051625at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.