DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7322 and C06E4.6

DIOPT Version :10

Sequence 1:NP_573333.2 Gene:CG7322 / 32880 FlyBaseID:FBgn0030968 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_501154.1 Gene:C06E4.6 / 182329 WormBaseID:WBGene00015535 Length:274 Species:Caenorhabditis elegans


Alignment Length:37 Identity:12/37 - (32%)
Similarity:17/37 - (45%) Gaps:7/37 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GRTALSELARRASQVFSESEWKLYCGSP-TLSHQEFT 106
            |....|..||||:.::.|      |.|. :||..:.|
 Worm   102 GYLICSREARRANNLYLE------CASSNSLSQSDIT 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7322NP_573333.2 XR_like_SDR_c 1..242 CDD:187609 12/37 (32%)
C06E4.6NP_501154.1 Rossmann-fold NAD(P)(+)-binding proteins 4..266 CDD:473865 12/37 (32%)

Return to query results.
Submit another query.