DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7322 and Dcxr

DIOPT Version :9

Sequence 1:NP_001259693.1 Gene:CG7322 / 32880 FlyBaseID:FBgn0030968 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_599214.1 Gene:Dcxr / 171408 RGDID:620031 Length:244 Species:Rattus norvegicus


Alignment Length:239 Identity:121/239 - (50%)
Similarity:162/239 - (67%) Gaps:6/239 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LAGKVILVTGAGAGIGQALVKQLASAGATVIAVARKPEQLQQLVAFDPVHIQPLQLDLSGWQAVR 69
            |||:..||||||.|||::.|..|.:|||.|:||:|..|.|..||...| .::|:.:||:.|:|..
  Rat     5 LAGRRALVTGAGKGIGRSTVLALQAAGAQVVAVSRTREDLDSLVRECP-GVEPVCVDLADWEATE 68

  Fly    70 EGLAKVPLLDGLVNNAGVAIIKPFEELTEQDFDTHFDVNIKAVFNVTQ----SLLPRLKDGASIV 130
            :.|:.|..:|.|||||.||.::||.|:|::..||.|:||.:||..|:|    .::.|...|| ||
  Rat    69 QALSNVGPVDLLVNNAAVATLQPFLEVTKEACDTSFNVNFRAVVQVSQIVARGMIARGVPGA-IV 132

  Fly   131 NVSSIASSRSFGGHTAYSATKAALDSLTKSLALELGPRKIRVNSVNPTVVLTKMGADNWSDPAKS 195
            ||||.||.|:...||.|.:||.|||.|||.:||||||.|||||:||||||:|.||..|||||.|:
  Rat   133 NVSSQASQRALTNHTVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTPMGRANWSDPHKA 197

  Fly   196 GPLLAHIPLNRFCEVQEVVDATGYLLSSKSSFVNGHHILLEGGY 239
            ..:|..|||.:|.||:.|||...:|||::||...|..:.::||:
  Rat   198 KVMLDRIPLGKFAEVENVVDTILFLLSNRSSMTTGSALPVDGGF 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7322NP_001259693.1 XR_like_SDR_c 1..242 CDD:187609 121/239 (51%)
DcxrNP_599214.1 XR_like_SDR_c 1..243 CDD:187609 121/239 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337385
Domainoid 1 1.000 205 1.000 Domainoid score I2818
eggNOG 1 0.900 - - E1_KOG1207
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H22964
Inparanoid 1 1.050 215 1.000 Inparanoid score I3529
OMA 1 1.010 - - QHG52160
OrthoDB 1 1.010 - - D1051625at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm46391
orthoMCL 1 0.900 - - OOG6_105139
Panther 1 1.100 - - LDO PTHR44252
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1266
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.