DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7322 and Cbr2

DIOPT Version :9

Sequence 1:NP_001259693.1 Gene:CG7322 / 32880 FlyBaseID:FBgn0030968 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_031647.1 Gene:Cbr2 / 12409 MGIID:107200 Length:244 Species:Mus musculus


Alignment Length:246 Identity:109/246 - (44%)
Similarity:154/246 - (62%) Gaps:6/246 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWTDLAGKVILVTGAGAGIGQALVKQLASAGATVIAVARKPEQLQQLVAFDPVHIQPLQLDLSGW 65
            |..:.:|...||||||.|||:..||.|.::||.|:||.|....|..|....| .|:|:.:||..|
Mouse     1 MKLNFSGLRALVTGAGKGIGRDTVKALHASGAKVVAVTRTNSDLVSLAKECP-GIEPVCVDLGDW 64

  Fly    66 QAVREGLAKVPLLDGLVNNAGVAIIKPFEELTEQDFDTHFDVNIKAVFNVTQ----SLLPRLKDG 126
            .|..:.|..:..:|.|||||.:.|::||.|:|::.||..|.||:::||.|:|    .::.|...|
Mouse    65 DATEKALGGIGPVDLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGVPG 129

  Fly   127 ASIVNVSSIASSRSFGGHTAYSATKAALDSLTKSLALELGPRKIRVNSVNPTVVLTKMGADNWSD 191
             |||||||:.:..:|.....||:||.|:..|||::|:||||.||||||||||||||.||....:|
Mouse   130 -SIVNVSSMVAHVTFPNLITYSSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGKKVSAD 193

  Fly   192 PAKSGPLLAHIPLNRFCEVQEVVDATGYLLSSKSSFVNGHHILLEGGYSVS 242
            |..:..|....||.:|.||::||::..:|||.:|:..:|..||::.||..|
Mouse   194 PEFARKLKERHPLRKFAEVEDVVNSILFLLSDRSASTSGGGILVDAGYLAS 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7322NP_001259693.1 XR_like_SDR_c 1..242 CDD:187609 108/244 (44%)
Cbr2NP_031647.1 XR_like_SDR_c 1..244 CDD:187609 108/244 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833837
Domainoid 1 1.000 207 1.000 Domainoid score I2875
eggNOG 1 0.900 - - E1_KOG1207
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I3586
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52160
OrthoDB 1 1.010 - - D1051625at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm44291
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44252
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1266
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.870

Return to query results.
Submit another query.