DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shop and Cyb5r2

DIOPT Version :9

Sequence 1:NP_573331.1 Gene:shop / 32878 FlyBaseID:FBgn0030966 Length:573 Species:Drosophila melanogaster
Sequence 2:XP_017177792.1 Gene:Cyb5r2 / 320635 MGIID:2444415 Length:304 Species:Mus musculus


Alignment Length:156 Identity:32/156 - (20%)
Similarity:51/156 - (32%) Gaps:38/156 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 HNTLEVLELLEGFRIGNLEGLVVTNVDDELGSPWSQEPQRHALLKPASKRPFNAEPPIGLLAEQF 232
            |||       ..||.|      :.:.|..||.|...  ..|.|.:..::....|..|:....:|.
Mouse    81 HNT-------RRFRFG------LPSPDHVLGLPVGN--YVHLLAQINNELVIRAYTPVSSDDDQG 130

  Fly   233 YTP--NELFYVRNHLPVPVINPEDYELEIEGGAKDK---------TLTLDGIKALPKHSVTAAIM 286
            :..  .::::...|...|           |||...:         |:...|......::....::
Mouse   131 FVDLIIKIYFKNVHPKYP-----------EGGKMTQYLENMKIGDTILFRGPTGRLFYNEPGTLL 184

  Fly   287 CGGNRRSEMTKVKAVKGLSWGAGAVG 312
            ...|:.||..| |.|..|...||..|
Mouse   185 IKANKTSEPEK-KLVHHLGMIAGGTG 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shopNP_573331.1 Cyt-b5 110..185 CDD:278597 6/16 (38%)
PLN00177 199..572 CDD:177772 23/125 (18%)
eukary_SO_Moco 211..572 CDD:239029 20/113 (18%)
Cyb5r2XP_017177792.1 PLN02252 <25..271 CDD:215141 32/156 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100179
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.