DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shop and SPCC970.03

DIOPT Version :9

Sequence 1:NP_573331.1 Gene:shop / 32878 FlyBaseID:FBgn0030966 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_587852.1 Gene:SPCC970.03 / 2539526 PomBaseID:SPCC970.03 Length:301 Species:Schizosaccharomyces pombe


Alignment Length:269 Identity:57/269 - (21%)
Similarity:93/269 - (34%) Gaps:116/269 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 WAG-----GLTLGYH--WLTDKKNHVLLEGQKVASEE----ELEATARLWHVT--NRRELPTYRA 113
            |.|     ..:||:|  |    :..|    :||.|::    ||...|.|.|.|  .|..||  ||
pombe    32 WVGYAIVVAFSLGFHKFW----RGRV----RKVLSDKIQQFELSDKAVLNHNTAIYRFRLP--RA 86

  Fly   114 EEV-----EQHNSV-----EKRIWVTY-------GLGVYDVTDFVENHPG------------GDK 149
            .:|     .||..|     .|....:|       ..|.:|:  .|:::|.            ||.
pombe    87 NDVLGLPIGQHLKVFVDVDGKEYSRSYTPLSSDADKGYFDL--LVKSYPNGKVSKKFSELKIGDT 149

  Fly   150 I--------------------LMAAGSAIDPFWGIYQQHNTLEVLELLEGFRIGNLEG-----LV 189
            |                    ::|.|:.|.|.         |:::..:    :.|.|.     |:
pombe   150 IGVRGPKGNWKHRTGLARHFGMIAGGTGITPM---------LQIIRAV----LSNFEDPTEITLL 201

  Fly   190 VTNVD-------DELGSPWSQEPQ---RHALLKPASKRPFNAEPPIGLLAEQFYTPNELFYVRNH 244
            ..||.       ||:.:...::|:   .:.|..|    |.|.:..:|.:.::.        ::.|
pombe   202 YANVSEGDIVLRDEIDALAKKDPRFTVHYVLNNP----PENWKGSVGFVTQEL--------IKAH 254

  Fly   245 LPVPVINPE 253
            .|.|  :||
pombe   255 FPAP--SPE 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shopNP_573331.1 Cyt-b5 110..185 CDD:278597 20/123 (16%)
PLN00177 199..572 CDD:177772 11/58 (19%)
eukary_SO_Moco 211..572 CDD:239029 9/43 (21%)
SPCC970.03NP_587852.1 PTZ00319 32..301 CDD:173521 57/269 (21%)
cyt_b5_reduct_like 64..301 CDD:99780 47/229 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100179
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.