DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shop and Cyb5r3

DIOPT Version :9

Sequence 1:NP_573331.1 Gene:shop / 32878 FlyBaseID:FBgn0030966 Length:573 Species:Drosophila melanogaster
Sequence 2:XP_006242127.1 Gene:Cyb5r3 / 25035 RGDID:2502 Length:307 Species:Rattus norvegicus


Alignment Length:207 Identity:39/207 - (18%)
Similarity:84/207 - (40%) Gaps:36/207 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 GLTLGYH-WLTDK--KNHVLLEGQKVASEEE---LEATARLWHVTNRRELP-----TYRAEEVEQ 118
            ||.:|.| :|:.:  .|.|:.....|:|:::   ::...:::......:.|     :...|.:..
  Rat    78 GLPIGQHIYLSTRIDGNLVIRPYTPVSSDDDKGFVDLVVKVYFKDTHPKFPAGGKMSQYLENMNI 142

  Fly   119 HNSVEKR----IWVTYGLGVYDVTDFVENHPGGDKI----LMAAGSAIDPFW----GIYQQHNTL 171
            .:::|.|    :.|..|.|.:.:....:::|....:    ::|.|:.|.|..    .:.:..|..
  Rat   143 GDTIEFRGPNGLLVYQGKGKFAIRADKKSNPVVRTVKSVGMIAGGTGITPMLQVIRAVLKDPNDH 207

  Fly   172 EVLELLEGFRIGNLEGLVVTNVDDELGSPWSQEPQRHALLKPASKRPFNAEPPIGLLAEQFYTPN 236
            .|..||  |...:.:.:::....:||.   ::...|..|.....|.|...:...|.:.|:.    
  Rat   208 TVCYLL--FANQSEKDILLRPELEELR---NEHSSRFKLWYTVDKAPDAWDYSQGFVNEEM---- 263

  Fly   237 ELFYVRNHLPVP 248
                :|:|||.|
  Rat   264 ----IRDHLPPP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shopNP_573331.1 Cyt-b5 110..185 CDD:278597 16/86 (19%)
PLN00177 199..572 CDD:177772 11/50 (22%)
eukary_SO_Moco 211..572 CDD:239029 9/38 (24%)
Cyb5r3XP_006242127.1 PTZ00319 22..307 CDD:173521 39/207 (19%)
cyt_b5_reduct_like 51..307 CDD:99780 39/207 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100179
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.