DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shop and T05H4.4

DIOPT Version :9

Sequence 1:NP_573331.1 Gene:shop / 32878 FlyBaseID:FBgn0030966 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_504639.1 Gene:T05H4.4 / 188150 WormBaseID:WBGene00020267 Length:303 Species:Caenorhabditis elegans


Alignment Length:128 Identity:28/128 - (21%)
Similarity:48/128 - (37%) Gaps:18/128 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 GGNRRSEMTKVKAVKGLSWGAGAVGNAKWSGARLCDILREQGVQPDET--KH--VIFEGADLDPT 348
            ||.....:..:|....:|: .|..|:..:.|:.|..:..::..:|...  ||  :|..|..:.|.
 Worm   126 GGKMSQHLESLKIGDTVSF-RGPHGSIIYKGSGLFTVRMDKKAEPKNRFFKHLSMIAGGTGITPM 189

  Fly   349 SHPYGA---------SIPLAKALDPRGDVILAYEMNDEPLSRDHGFPIRVIVPGTVGARNVKW 402
            .....|         .|.|..|.....|::...|:::  |:..|  |.|..|..||...:..|
 Worm   190 LQVIAAILRDPIDATQIRLLFANQTEDDILCRKELDE--LAEKH--PTRFRVWYTVSKASKDW 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shopNP_573331.1 Cyt-b5 110..185 CDD:278597
PLN00177 199..572 CDD:177772 28/128 (22%)
eukary_SO_Moco 211..572 CDD:239029 28/128 (22%)
T05H4.4NP_504639.1 PTZ00319 11..303 CDD:173521 28/128 (22%)
cyt_b5_reduct_like 47..303 CDD:99780 28/128 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100179
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.