DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shop and AgaP_AGAP011314

DIOPT Version :9

Sequence 1:NP_573331.1 Gene:shop / 32878 FlyBaseID:FBgn0030966 Length:573 Species:Drosophila melanogaster
Sequence 2:XP_309336.4 Gene:AgaP_AGAP011314 / 1270621 VectorBaseID:AGAP011314 Length:488 Species:Anopheles gambiae


Alignment Length:163 Identity:42/163 - (25%)
Similarity:61/163 - (37%) Gaps:27/163 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 TNRRELPTYRAEEVEQHNSVEKRIWVTYGLGVYDVTDFVENHPGG-DKILMAAGSAIDPFWGIYQ 166
            |..|.:|...| |:.:|:..|. .|:.....||:||.::..|||| |:::..||.  |......:
Mosquito    33 TGGRIVPVSHA-ELAKHDRAED-AWMAIRGKVYNVTRYMNFHPGGADELMRGAGK--DATRLFEE 93

  Fly   167 QHNTLEVLELLEGFRIGNLEGLVVTNVDDELGSPWSQEPQRHALLKPASKRPFNAEPPI------ 225
            .|..:....||....||.|.....|:..       |..|...:::..||........||      
Mosquito    94 VHAWVNYESLLAKCYIGPLRNTDTTDTA-------STTPPPPSIVSSASDDSLKLSIPIVPRFDW 151

  Fly   226 ----GLLAEQFYT-----PNELFYVRNHLPVPV 249
                ..|...|||     |..:....:||.|.|
Mosquito   152 IQKTAELTLIFYTRSLANPGVMVECVDHLEVTV 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shopNP_573331.1 Cyt-b5 110..185 CDD:278597 22/75 (29%)
PLN00177 199..572 CDD:177772 15/66 (23%)
eukary_SO_Moco 211..572 CDD:239029 13/54 (24%)
AgaP_AGAP011314XP_309336.4 Cyt-b5 40..112 CDD:278597 22/75 (29%)
p23_NCB5OR 149..235 CDD:107240 9/36 (25%)
cyt_b5_reduct_like 252..486 CDD:99780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.