DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htk and ECM5

DIOPT Version :9

Sequence 1:NP_573330.3 Gene:htk / 32877 FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_013901.1 Gene:ECM5 / 855214 SGDID:S000004788 Length:1411 Species:Saccharomyces cerevisiae


Alignment Length:292 Identity:60/292 - (20%)
Similarity:118/292 - (40%) Gaps:70/292 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 EVVNEKE------ENIGKVVCVETESKKKDK-EKW----------------------FPALVVAP 201
            |.||||.      ....|:..:|.|.:::.. ::|                      |.:...||
Yeast    16 EPVNEKVMVQNGFHESSKIADIELEIQERPSIKQWESPRSAVIPTSNHNFSPFLYTQFKSRGAAP 80

  Fly   202 TAQATVR----IRVKDEYLVRSF--KDGRYYTVPKKEATEFTREVASKQDVPAVQAALEFLDSSV 260
            .|..|::    :.:.:....|.|  |.|.:|.:.......|   :.:|:::|......|.::   
Yeast    81 FAPETIKSVDLVELPEGVPARVFHEKTGLFYQISPHSIPTF---ILAKKELPDPIKFYELVE--- 139

  Fly   261 LPAHWDRDSLFGLTNISSDDEGE------IDSD-----------SSDDEPHEEKDRFVAQLYKYM 308
                 |..|::|...:....:.:      :|.|           :|::....:...|.|:||.:.
Yeast   140 -----DLGSVYGCVKLKIIPDADKFTQLNVDVDRLWFKARKQFFNSNEFQRTKIVDFYAKLYNFH 199

  Fly   309 DD-RGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVSVMNL-VK 371
            :. :.:.|.::|||..|.:|||||...|:.|||:|.|..:..|..|...||::...:|.::. ::
Yeast   200 NKIKKSTLTRIPSIDKRTLDLYRLRSCVKLRGGFNAVCEKKLWAQIGRELGYSGRIMSSLSTSLR 264

  Fly   372 QAYKKFLQPYGDFHRKLGCSMLMTSRNSNRSK 403
            .||.|.|..:..:..:     ...:||:.:::
Yeast   265 SAYAKILLDFDIYEEE-----EQAARNNEKNE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 19/125 (15%)
ARID 299..381 CDD:279697 29/83 (35%)
Tudor-knot 692..751 CDD:288553
ECM5NP_013901.1 BRIGHT 187..280 CDD:128777 29/92 (32%)
cupin_RmlC-like 512..662 CDD:424065
PHD_Ecm5p_Lid2p_like 1240..1287 CDD:276993
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1374
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.