Sequence 1: | NP_573330.3 | Gene: | htk / 32877 | FlyBaseID: | FBgn0085451 | Length: | 2486 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001161697.1 | Gene: | Morf4l2 / 56397 | MGIID: | 1927167 | Length: | 288 | Species: | Mus musculus |
Alignment Length: | 205 | Identity: | 39/205 - (19%) |
---|---|---|---|
Similarity: | 61/205 - (29%) | Gaps: | 95/205 - (46%) |
- Green bases have known domain annotations that are detailed below.
Fly 1083 SSTELSSET--ESYADED-----SQSSDYRKQLKGSGAGKKEPTASPSKLHHEPVTKRELAVKEE 1140
Fly 1141 PLKIEPKTEPKEEETKSKPFLSGADIKPTALIAPARFGNTSAAQAASSSGSSSTTAKYTSVIVEK 1205
Fly 1206 PLTIGGKKSVEQHVPKKAELLKKQSGGAGGTAASSSAASQESKK---FAEPVA----------SL 1257
Fly 1258 KVEMPAACSP 1267 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
htk | NP_573330.3 | RBB1NT | 171..262 | CDD:285392 | |
ARID | 299..381 | CDD:279697 | |||
Tudor-knot | 692..751 | CDD:288553 | |||
Morf4l2 | NP_001161697.1 | PLN02967 | 1..>150 | CDD:215521 | 39/205 (19%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..115 | 35/187 (19%) | |||
MRG | 102..276 | CDD:368575 | 6/30 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1624495at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |