DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htk and morf4l1

DIOPT Version :9

Sequence 1:NP_573330.3 Gene:htk / 32877 FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_001002604.2 Gene:morf4l1 / 436877 ZFINID:ZDB-GENE-040718-348 Length:323 Species:Danio rerio


Alignment Length:107 Identity:29/107 - (27%)
Similarity:42/107 - (39%) Gaps:32/107 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   711 HGS-TYEAKVIEISVQRGVPMYLVHYTGWNNRYDEWVPRERIAE----NLTK------------- 757
            ||. .||||.::|:::.....|.:||:|||..:|||||..|:.:    ||.|             
Zfish    21 HGPLLYEAKCVKINIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDSNLQKQKELQKANQDHYV 85

  Fly   758 --------------GSKQKTRTISTSSANSGSGGGGGGGGGG 785
                          ..:||...:.|......:.|.|.|...|
Zfish    86 EGRMRGVAPSKKIAAVQQKNVDVKTKKNKQKTPGAGEGTSTG 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697
Tudor-knot 692..751 CDD:288553 18/40 (45%)
morf4l1NP_001002604.2 Tudor-knot 11..64 CDD:288553 19/42 (45%)
MRG 135..309 CDD:283390
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.