DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htk and Morf4l2

DIOPT Version :9

Sequence 1:NP_573330.3 Gene:htk / 32877 FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_001007715.1 Gene:Morf4l2 / 317413 RGDID:1359471 Length:288 Species:Rattus norvegicus


Alignment Length:193 Identity:41/193 - (21%)
Similarity:64/193 - (33%) Gaps:71/193 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly  1083 SSTELSSET--ESYADED-----SQSSDYRKQLKGSGAGKKEPTASPSKLHHEPVTKRELAVKEE 1140
            ||.:.:|:|  :..|:||     ::|:..|.:::|:.:|||...:.|..|  :|.          
  Rat     2 SSRKQASQTRGQQSAEEDNFKKPTRSNMQRSKMRGAASGKKSAGSQPKNL--DPA---------- 54

  Fly  1141 PLKIEPKTEPKEEETKSKPFLSGADIKPTALIAPARFGNTSAAQAASSSGSSSTTAKYTSVIVEK 1205
                                            .|.|:|..||..  ..|||...|.|      .|
  Rat    55 --------------------------------LPGRWGGRSAEN--PPSGSVRKTRK------NK 79

  Fly  1206 PLTIG-GKKSVEQHVPKKAELLKKQSGGAGGTAASSSAASQESKKFAEPVASLKVEMPAACSP 1267
            ..|.| |.......||:..   :|:...|..|..|..|.....:        :||::|....|
  Rat    80 QKTPGNGDGGSTSEVPQPP---RKKRARADPTVESEEAFKSRME--------VKVKIPEELKP 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697
Tudor-knot 692..751 CDD:288553
Morf4l2NP_001007715.1 PLN02967 1..>150 CDD:215521 41/193 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115 36/167 (22%)
MRG 110..276 CDD:399022 6/30 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.