Sequence 1: | NP_573330.3 | Gene: | htk / 32877 | FlyBaseID: | FBgn0085451 | Length: | 2486 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_008764667.1 | Gene: | Morf4l1 / 300891 | RGDID: | 1307938 | Length: | 362 | Species: | Rattus norvegicus |
Alignment Length: | 246 | Identity: | 47/246 - (19%) |
---|---|---|---|
Similarity: | 75/246 - (30%) | Gaps: | 89/246 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 711 HGS-TYEAKVIEISVQRGVPMYLVHYTGWNNR--------------------------------- 741
Fly 742 ------YDEWVPRERIAENLTKGSKQKTRTISTSSANSGSGGGGGGGGGGGGGGGGGGGSLLVQG 800
Fly 801 SQPPGVSDKQPGKDGCSKMSPSSGNSTGPGAPSLSGSLGGASSTPSLLSTVVKTPPTGGAKRGRG 865
Fly 866 RSDSMPPRSTTPSSVVAHSGRTKSPAASQPQL---------QQQMKKRPTR 907 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
htk | NP_573330.3 | RBB1NT | 171..262 | CDD:285392 | |
ARID | 299..381 | CDD:279697 | |||
Tudor-knot | 692..751 | CDD:288553 | 17/79 (22%) | ||
Morf4l1 | XP_008764667.1 | Tudor-knot | 11..103 | CDD:288553 | 18/81 (22%) |
MRG | 174..348 | CDD:283390 | 12/55 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1624495at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |