DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htk and mrg-1

DIOPT Version :9

Sequence 1:NP_573330.3 Gene:htk / 32877 FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_001122727.1 Gene:mrg-1 / 176702 WormBaseID:WBGene00003406 Length:337 Species:Caenorhabditis elegans


Alignment Length:77 Identity:25/77 - (32%)
Similarity:38/77 - (49%) Gaps:18/77 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   712 GSTYEAKVIEISVQR-GVPMYLVHYTGWNNRYDEWVP----RERI-------------AENLTKG 758
            |..|:||:.:|.... |..:|.||:.||||||||.:|    ::||             ||..|..
 Worm    19 GKPYDAKITDIKTNSDGKELYCVHFKGWNNRYDEKIPVGEEKDRIFKGTASEYAEKHNAELPTTA 83

  Fly   759 SKQKTRTISTSS 770
            .|.|.::::..:
 Worm    84 LKPKKKSLAAEA 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697
Tudor-knot 692..751 CDD:288553 18/43 (42%)
mrg-1NP_001122727.1 CD_CSD <19..63 CDD:421697 18/43 (42%)
MRG 125..316 CDD:399022
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8513
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.