DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf1 and pdgfbb

DIOPT Version :9

Sequence 1:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_005171668.1 Gene:pdgfbb / 796490 ZFINID:ZDB-GENE-131121-332 Length:483 Species:Danio rerio


Alignment Length:239 Identity:53/239 - (22%)
Similarity:96/239 - (40%) Gaps:50/239 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LEGSCCQGAAAEAGTPLTLPL-------SVSA--ELTNVTADYDVSGEMPSSKENFKRSIMKSTV 134
            |..:|.:..:||| .||...:       |||:  :|..:.....:..|..|..:|...:.:..::
Zfish    12 LAAACLRFGSAEA-DPLPAAVVELVKAGSVSSIQDLQFLLFSESIEVEPDSHHDNDSSNRLPRSL 75

  Fly   135 RNATPAS---CSPQPTIVELKPPAEDEAN--YYYMPACTRISRCNGCCGSTLISCQPTEVEQVQL 194
            .:|.||.   |..:..::|:.....|.:|  :...|.|..:.||:|||.:..:.|.|.......|
Zfish    76 LDAQPAQQAICKVRTEVIEVTRSMLDRSNADFLLWPPCVEVQRCSGCCNTKTLQCVPVLTHTRYL 140

  Fly   195 RVRKVDRAATSGRRPF---TIITVEQHTQCRC-----------------DCRTKAEDCNVYQS-Y 238
            :|.|:....   :||.   .:::|..|.:|||                 |.|.::|.....:. :
Zfish   141 QVMKIQYVK---KRPLYDKAVVSVLDHVECRCQPAPRPAHRRKSSSQKLDARDRSEKSRPKEDLH 202

  Fly   239 RKDLCRCECHNTDARDKCLEQAENKYWVDDNCTCVCRYNQSCTT 282
            |:|..:   ||....   ||...:..|:..:     |:::|..|
Zfish   203 RRDELK---HNQRLN---LEDLLSHSWLPQD-----RFSESPDT 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf1NP_523407.1 PDGF 142..223 CDD:278756 21/85 (25%)
pdgfbbXP_005171668.1 PDGF 86..169 CDD:306779 21/85 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582433
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C4GD
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11633
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1138
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.