DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf1 and pdgfab

DIOPT Version :9

Sequence 1:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001070225.1 Gene:pdgfab / 767790 ZFINID:ZDB-GENE-060929-124 Length:230 Species:Danio rerio


Alignment Length:112 Identity:30/112 - (26%)
Similarity:55/112 - (49%) Gaps:5/112 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 SGEMPSSKENFKRSIMKSTVRNATPASCSPQPTIVELKPPAED--EANYYYMPACTRISRCNGCC 177
            :.::.|.:.:.:|.  :|.|..|.||.|..:..|.|:.....|  .||:...|.|..:.||.|||
Zfish    80 ASDLKSRQLSHRRK--RSIVEEAVPAMCKTRTVIYEIPRSQVDPTAANFLIWPPCVEVKRCTGCC 142

  Fly   178 GSTLISCQPTEVEQVQLRVRKVDRAA-TSGRRPFTIITVEQHTQCRC 223
            .:..:.|.|::.:...::|.||:.|: ...:....::.:|.|.:|.|
Zfish   143 NTGNMRCHPSKKQHRTVKVAKVEFASRKKAKLKEVLVRLEDHLECIC 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf1NP_523407.1 PDGF 142..223 CDD:278756 22/83 (27%)
pdgfabNP_001070225.1 PDGF_N 22..104 CDD:368059 6/25 (24%)
PDGF 105..189 CDD:366040 22/83 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582435
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11633
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1138
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.