DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf1 and Pdgfd

DIOPT Version :10

Sequence 1:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_082200.1 Gene:Pdgfd / 71785 MGIID:1919035 Length:370 Species:Mus musculus


Alignment Length:179 Identity:35/179 - (19%)
Similarity:65/179 - (36%) Gaps:34/179 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 DPSAAPGALEGSCCQGAAAEAGTPLTLPLSVSAELTNVTAD---------YDVSGEMPSSK--EN 124
            ||:....||:.:..:....|.......|:|...:|.|:..|         :|...::...:  ::
Mouse   202 DPTLTADALDKTVAEFDTVEDLLKHFNPVSWQDDLENLYLDTPHYRGRSYHDRKSKVDLDRLNDD 266

  Fly   125 FKRSIMKSTVRNATPASCSPQPTIVELKPPAEDEANYYYMPACTRISRCNGCCGSTLI-----SC 184
            .||            .||:|:...|.|:...: ..|..:.|.|..:.||.|.||...:     :|
Mouse   267 VKR------------YSCTPRNHSVNLREELK-LTNAVFFPRCLLVQRCGGNCGCGTVNWKSCTC 318

  Fly   185 QPTEVEQVQLRVRKVD-----RAATSGRRPFTIITVEQHTQCRCDCRTK 228
            ...:..:....|.|.:     |...:.......|.::.|.:|.|.|.::
Mouse   319 SSGKTVKKYHEVLKFEPGHFKRRGKAKNMALVDIQLDHHERCDCICSSR 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf1NP_523407.1 PDGF 140..226 CDD:238079 21/95 (22%)
PdgfdNP_082200.1 CUB 55..169 CDD:238001
PDGF 270..365 CDD:238079 21/95 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.