DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf1 and pdgfc

DIOPT Version :9

Sequence 1:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_021330008.1 Gene:pdgfc / 560564 ZFINID:ZDB-GENE-071217-2 Length:343 Species:Danio rerio


Alignment Length:221 Identity:47/221 - (21%)
Similarity:82/221 - (37%) Gaps:56/221 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SSSTQTKVRLLRQADDPSAAPGALEGSCCQGAAAEAGTPLTLPLSVS--AELTNVTADYDVSGEM 118
            |...|..||.:.....||....::..|..|...:|...|..:|:.:.  .:||...:.::...|:
Zfish   133 SKGNQILVRFVSDEYFPSDPGFSIRYSLLQQRQSEPEAPAVMPVWMQPVEDLTEAVSAFNTMEEV 197

  Fly   119 PSSKE------------------------NFKRS-------IMKSTVRNATPASCSPQPTIVELK 152
            ....|                        :.|:|       :::..||   ..||:|:...|.|:
Zfish   198 MKYLEPERWQLDMDDLYKPTWQVLGKSFFHQKKSRGAVDLNLLREDVR---LYSCTPRNFSVSLR 259

  Fly   153 PPAEDEANYYYMPACTRISRCNG---CCGSTLISCQ--PTEV-----EQVQLRVRKVDRAATSGR 207
            ...: ..:..:.|:|..:.||.|   ||......||  ||:|     |.:.|:.|      |.||
Zfish   260 EELK-RTDAIFWPSCLLVKRCGGNCACCSYNCYDCQCSPTKVAKKYHEVLMLKHR------TGGR 317

  Fly   208 ---RPFTIITVEQHTQCRCDCRTKAE 230
               :....:.:|.|.:|.|.|:..::
Zfish   318 GLQKTLADVPLEHHEECNCVCKNDSD 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf1NP_523407.1 PDGF 142..223 CDD:278756 25/93 (27%)
pdgfcXP_021330008.1 CUB 54..158 CDD:214483 6/24 (25%)
PDGF 247..339 CDD:238079 27/98 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11633
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.