Sequence 1: | NP_523407.1 | Gene: | Pvf1 / 32876 | FlyBaseID: | FBgn0030964 | Length: | 325 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021330008.1 | Gene: | pdgfc / 560564 | ZFINID: | ZDB-GENE-071217-2 | Length: | 343 | Species: | Danio rerio |
Alignment Length: | 221 | Identity: | 47/221 - (21%) |
---|---|---|---|
Similarity: | 82/221 - (37%) | Gaps: | 56/221 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 SSSTQTKVRLLRQADDPSAAPGALEGSCCQGAAAEAGTPLTLPLSVS--AELTNVTADYDVSGEM 118
Fly 119 PSSKE------------------------NFKRS-------IMKSTVRNATPASCSPQPTIVELK 152
Fly 153 PPAEDEANYYYMPACTRISRCNG---CCGSTLISCQ--PTEV-----EQVQLRVRKVDRAATSGR 207
Fly 208 ---RPFTIITVEQHTQCRCDCRTKAE 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pvf1 | NP_523407.1 | PDGF | 142..223 | CDD:278756 | 25/93 (27%) |
pdgfc | XP_021330008.1 | CUB | 54..158 | CDD:214483 | 6/24 (25%) |
PDGF | 247..339 | CDD:238079 | 27/98 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR11633 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |