DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf1 and PDGFC

DIOPT Version :9

Sequence 1:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_057289.1 Gene:PDGFC / 56034 HGNCID:8801 Length:345 Species:Homo sapiens


Alignment Length:100 Identity:27/100 - (27%)
Similarity:45/100 - (45%) Gaps:22/100 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 SCSPQPTIVELKPPAEDEANYYYMPACTRISRCNGCCGSTLISCQ-----PTEV-----EQVQLR 195
            ||:|:...|.::...: ..:..:.|.|..:.||.|.|...|.:|.     |::|     |.:|||
Human   249 SCTPRNFSVSIREELK-RTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLR 312

  Fly   196 ----VRKVDRAATSGRRPFTIITVEQHTQCRCDCR 226
                ||.:.::.|.       :.:|.|.:|.|.||
Human   313 PKTGVRGLHKSLTD-------VALEHHEECDCVCR 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf1NP_523407.1 PDGF 142..223 CDD:278756 23/94 (24%)
PDGFCNP_057289.1 CUB 49..162 CDD:238001
PDGF 248..340 CDD:238079 25/98 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11633
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.