DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf1 and PDGFB

DIOPT Version :9

Sequence 1:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_002599.1 Gene:PDGFB / 5155 HGNCID:8800 Length:241 Species:Homo sapiens


Alignment Length:129 Identity:38/129 - (29%)
Similarity:65/129 - (50%) Gaps:12/129 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 AEL-TNVTADYDVSGEMPSSKENFKRSIMKSTVRN-ATPASCSPQPTIVELKPPAED--EANYYY 163
            ||| .|:|..:. .||:.|.... :||:...|:.. |..|.|..:..:.|:.....|  .||:..
Human    58 AELDLNMTRSHS-GGELESLARG-RRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLV 120

  Fly   164 MPACTRISRCNGCCGSTLISCQPTEVEQVQLRVRKVDRAATSGRRPF---TIITVEQHTQCRCD 224
            .|.|..:.||:|||.:..:.|:||:|:...::|||::...   ::|.   ..:|:|.|..|:|:
Human   121 WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVR---KKPIFKKATVTLEDHLACKCE 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf1NP_523407.1 PDGF 142..223 CDD:278756 24/85 (28%)
PDGFBNP_002599.1 PDGF_N 21..93 CDD:398391 11/36 (31%)
PDGF 97..180 CDD:395270 24/85 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..241
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148525
Domainoid 1 1.000 57 1.000 Domainoid score I10898
eggNOG 1 0.900 - - E1_2C4GD
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42132
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11633
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1138
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.