DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf1 and PDGFA

DIOPT Version :9

Sequence 1:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_011513717.1 Gene:PDGFA / 5154 HGNCID:8799 Length:256 Species:Homo sapiens


Alignment Length:184 Identity:46/184 - (25%)
Similarity:68/184 - (36%) Gaps:43/184 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 QADDPSAAPG-------ALEGSC-CQGAAAEAGTPLTLPLSVSAELTNVTADYDVSGEMPSSKEN 124
            |...|.|.||       :|:.|. ..|..|....|...||.:..                     
Human    86 QHPGPPATPGDRLRSEDSLDTSLRAHGVHATKHVPEKRPLPIRR--------------------- 129

  Fly   125 FKRSIMKSTVRNATPASCSPQPTIVELKPPAED--EANYYYMPACTRISRCNGCCGSTLISCQPT 187
             ||||     ..|.||.|..:..|.|:.....|  .||:...|.|..:.||.|||.::.:.|||:
Human   130 -KRSI-----EEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPS 188

  Fly   188 EVEQVQLRVRKVDRAATSGRRPFTIITVEQHTQCRCDCRTKAEDCNVYQSYRKD 241
            .|....::|.||:......:.....:.:|:|.:|.|...:...|      ||::
Human   189 RVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPD------YREE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf1NP_523407.1 PDGF 142..223 CDD:278756 23/82 (28%)
PDGFAXP_011513717.1 PDGF_N <101..140 CDD:282538 13/65 (20%)
PDGF 139..226 CDD:197537 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148526
Domainoid 1 1.000 57 1.000 Domainoid score I10898
eggNOG 1 0.900 - - E1_2C4GD
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42132
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11633
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4285
SonicParanoid 1 1.000 - - X1138
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.