DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf1 and pdgfaa

DIOPT Version :9

Sequence 1:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_919407.2 Gene:pdgfaa / 378480 ZFINID:ZDB-GENE-030918-2 Length:194 Species:Danio rerio


Alignment Length:201 Identity:45/201 - (22%)
Similarity:73/201 - (36%) Gaps:47/201 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 CCQGAAAEAGTPLTLPLSVSAELTN------------VTADYDVSGEMPSSKE-----------N 124
            ||....:.|.....:|..:...|:|            :..|:..:..:...|:           |
Zfish    11 CCFSLLSAAAEEAPIPRELIERLSNSEIHSISDLQRILEMDFLENEVLEDVKQGHHKEHLYDSRN 75

  Fly   125 FK--RSIMKSTVRNATPASCSPQPTIVELKPPAED--EANYYYMPACTRISRCNGCCGSTLISCQ 185
            .|  .|..|.::..|.||.|..:..|.|:.....|  .||:...|.|..:.||:|||.::.:.|.
Zfish    76 LKNLHSRRKRSIEEAVPAVCKTRTVIYEIPRSQVDPTAANFLIWPPCVEVRRCSGCCNTSNMRCH 140

  Fly   186 PTEVEQVQLRVRKVDRAATSGRRP---FTIITVEQHTQCRCDCRTKAEDCNVYQSYRKDLCRCEC 247
            |::.....::|.||:...   |||   ...:.:|.|.:|.|..|..:|.              ..
Zfish   141 PSKKHHRNVKVAKVEYVR---RRPKLREVQVQLEDHLECVCTSRHHSES--------------RI 188

  Fly   248 HNTDAR 253
            |..|.|
Zfish   189 HTADIR 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf1NP_523407.1 PDGF 142..223 CDD:278756 24/85 (28%)
pdgfaaNP_919407.2 PDGF_N 21..94 CDD:309710 11/72 (15%)
PDGF 95..178 CDD:306779 24/85 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582436
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C4GD
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11633
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4285
SonicParanoid 1 1.000 - - X1138
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.