DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf1 and Vegfd

DIOPT Version :9

Sequence 1:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_113949.2 Gene:Vegfd / 360457 RGDID:620695 Length:326 Species:Rattus norvegicus


Alignment Length:203 Identity:48/203 - (23%)
Similarity:79/203 - (38%) Gaps:43/203 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 CSPQPTIVELKPPAEDEANYYYMPACTRISRCNGCCGSTLISCQPTEVEQVQLRVRKVDRAATSG 206
            |||:.|.||:........|.::.|.|..:.||.|||....:.|..|....:..::.::....|| 
  Rat   116 CSPRETCVEVASELGKTTNTFFKPPCVNVFRCGGCCNEESVMCMNTSTSYISKQLFEISVPLTS- 179

  Fly   207 RRPFTI-ITVEQHTQCRC--------------DCRTKAED-CNVYQSYRKDLCRCECHNTDARDK 255
             .|..: :.:..||.|:|              ..:...|| |    .:.|.||..:....:.:.|
  Rat   180 -VPELVPVKIANHTGCKCLPTGPRHPYSIIRRSIQIPEEDQC----PHSKKLCPVDMLWDNTKCK 239

  Fly   256 CLEQAENKY-WVDDNCTCVCRYNQS---CTTGTVFDETQCKCTDPA-APIDVLDRKRFIVQAVQV 315
            |:.|.||.. ..:|:     .|.|.   |....:|||.:|:|...| .|.|::..          
  Rat   240 CVLQDENPLPGTEDH-----SYLQEPALCGPHMMFDEDRCECVCKAPCPGDLIQH---------- 289

  Fly   316 DPDNTTLY 323
             |:|.:.:
  Rat   290 -PENCSCF 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf1NP_523407.1 PDGF 142..223 CDD:278756 22/81 (27%)
VegfdNP_113949.2 PDGF 114..198 CDD:197537 23/83 (28%)
4 X 16 AA repeats of C-X(10)-C-X-C-X(1,3)-C 227..317 20/86 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.