DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf1 and vegfaa

DIOPT Version :9

Sequence 1:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_009290293.1 Gene:vegfaa / 30682 ZFINID:ZDB-GENE-990415-273 Length:207 Species:Danio rerio


Alignment Length:91 Identity:28/91 - (30%)
Similarity:49/91 - (53%) Gaps:5/91 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 ASCSPQPTIVELKPPAEDEANYYYMPACTRISRCNGCCGSTLISCQPTEVEQVQLRVRKVDRAAT 204
            ::|..:..:|::.....||..:.|:|:|..:.||.|||....:.|.|||...|.:.|.:|.:..:
Zfish    47 SACKTRELLVDIIQEYPDEIEHTYIPSCVVLMRCAGCCNDEALECVPTETRNVTMEVLRVKQRVS 111

  Fly   205 SGRRPFTIITVEQHTQCRCDCRTKAE 230
              :..|. ::..:||  :|:||.|||
Zfish   112 --QHNFQ-LSFTEHT--KCECRPKAE 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf1NP_523407.1 PDGF 142..223 CDD:278756 22/80 (28%)
vegfaaXP_009290293.1 PDGF 49..127 CDD:278756 23/82 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10814
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto38794
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4285
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.