DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf1 and Pdgfb

DIOPT Version :9

Sequence 1:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_113712.1 Gene:Pdgfb / 24628 RGDID:3283 Length:241 Species:Rattus norvegicus


Alignment Length:216 Identity:50/216 - (23%)
Similarity:87/216 - (40%) Gaps:49/216 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LILPVLLLVLIVSEAAAGSLVSPNNRQPSQRFFYAAATSSSSTQTKVRLLRQADDPSAAPGALEG 81
            |.||:...:.:||  |.|        .|.....|...:..|        :|..||       |:.
  Rat     7 LFLPLCCYLRLVS--AEG--------DPIPEELYEMLSDHS--------IRSFDD-------LQR 46

  Fly    82 SCCQGAAAEAGTPLTLPLSVSAELTNVTADYDVSGEMPSSKENFKRSIMKSTVRNATP---ASCS 143
            ...:.:..|.|..|.|         |:|..:  ||....|....:||:  .::..|.|   |.|.
  Rat    47 LLHRDSVDEDGAELDL---------NMTRAH--SGVESESSSRGRRSL--GSLAAAEPAVIAECK 98

  Fly   144 PQPTIVELKPPAED--EANYYYMPACTRISRCNGCCGSTLISCQPTEVEQVQLRVRKVDRAATSG 206
            .:..:.::.....|  .||:...|.|..:.||:|||.:..:.|:.::|:...::|||::...   
  Rat    99 TRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVR--- 160

  Fly   207 RRPF---TIITVEQHTQCRCD 224
            ::|.   ..:|:|.|..|:|:
  Rat   161 KKPVFKKATVTLEDHLACKCE 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf1NP_523407.1 PDGF 142..223 CDD:278756 21/85 (25%)
PdgfbNP_113712.1 PDGF_N 21..>71 CDD:309710 15/83 (18%)
PDGF 97..180 CDD:306779 21/85 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342418
Domainoid 1 1.000 57 1.000 Domainoid score I10627
eggNOG 1 0.900 - - E1_2C4GD
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11633
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1138
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.800

Return to query results.
Submit another query.