DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf1 and VEGFD

DIOPT Version :9

Sequence 1:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_004460.1 Gene:VEGFD / 2277 HGNCID:3708 Length:354 Species:Homo sapiens


Alignment Length:188 Identity:44/188 - (23%)
Similarity:67/188 - (35%) Gaps:44/188 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 CSPQPTIVELKPPAEDEANYYYMPACTRISRCNGCCGSTLISCQPTEVEQVQLRVRKVDRAATSG 206
            |||:.|.||:........|.::.|.|..:.||.|||....:.|..|....:..::.::....|| 
Human   111 CSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTS- 174

  Fly   207 RRPFTI-ITVEQHTQCRC--------------DCRTKAED-CNVYQSYRKDLCRCECHNTDARDK 255
             .|..: :.|..||.|:|              ..:...|| |    |:.|.||..:......:.|
Human   175 -VPELVPVKVANHTGCKCLPTAPRHPYSIIRRSIQIPEEDRC----SHSKKLCPIDMLWDSNKCK 234

  Fly   256 CLEQAEN--------------------KYWVDDNCTCVCRYNQSCTTGTVFDETQCKC 293
            |:.|.||                    ..:.:|.|.|||:  ..|....:.....|.|
Human   235 CVLQEENPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCK--TPCPKDLIQHPKNCSC 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf1NP_523407.1 PDGF 142..223 CDD:278756 23/81 (28%)
VEGFDNP_004460.1 PDGF 109..193 CDD:197537 24/83 (29%)
4 X 16 AA repeats of C-X(10)-C-X-C-X(1,3)-C 222..318 14/71 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.880

Return to query results.
Submit another query.