DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf1 and Vegfb

DIOPT Version :9

Sequence 1:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_035827.1 Gene:Vegfb / 22340 MGIID:106199 Length:207 Species:Mus musculus


Alignment Length:96 Identity:26/96 - (27%)
Similarity:48/96 - (50%) Gaps:8/96 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 ASCSPQPTIVELKPPAEDEANYYYMPACTRISRCNGCCGSTLISCQPTEVEQVQLRVRKVDRAAT 204
            |:|.|:..:|.|............:|:|..:.||.|||....:.|.||...||::::..:...::
Mouse    45 ATCQPREVVVPLSMELMGNVVKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIQYPSS 109

  Fly   205 S-GRRPFTIITVEQHTQCRCDCRTKAEDCNV 234
            . |.     :::|:|:|  |:||.|.::..|
Mouse   110 QLGE-----MSLEEHSQ--CECRPKKKESAV 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf1NP_523407.1 PDGF 142..223 CDD:278756 20/81 (25%)
VegfbNP_035827.1 PDGF 45..126 CDD:197537 23/87 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..178 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.