DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf1 and Vegfa

DIOPT Version :9

Sequence 1:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001020421.2 Gene:Vegfa / 22339 MGIID:103178 Length:392 Species:Mus musculus


Alignment Length:303 Identity:66/303 - (21%)
Similarity:107/303 - (35%) Gaps:95/303 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NRQPSQRFFYAAATSSSSTQTKVRLLRQADDPSAAP---GALEGS---------CCQGAAAEAGT 93
            :::||.....||..:.|:...:.   .||...::.|   ||.:|:         ..:|:|:.||.
Mouse   111 SQEPSSWTGEAAVCADSAPAARA---PQAPARASVPEGRGARQGAQESGLPRSPSRRGSASRAGP 172

  Fly    94 ----------------PLTLPLSVS----AELTNVTADYDVSGEMPSSKENFKRSIMKSTVRNAT 138
                            .|.|.|.:.    ::....|.....|.|:....:.::||.         
Mouse   173 GRASETMNFLLSWVHWTLALLLYLHHAKWSQAAPTTEGEQKSHEVIKFMDVYQRSY--------- 228

  Fly   139 PASCSPQPTIVELKPPAEDEANYYYMPACTRISRCNGCCGSTLISCQPTEVEQVQLRVRKV--DR 201
               |.|..|:|::.....||..|.:.|:|..:.||.|||....:.|.||....:.:::.::  .:
Mouse   229 ---CRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQ 290

  Fly   202 AATSGRRPFTIITVEQHTQCRC---DCRTKAE-------------------------DCNVYQSY 238
            :...|...|.     ||::|.|   ..|||.|                         .|......
Mouse   291 SQHIGEMSFL-----QHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSER 350

  Fly   239 RKDL-------CRCECHNTDARDKCLEQAENKYWVDDNCTCVC 274
            ||.|       |:|.|.|||:|.|..:...|:.      ||.|
Mouse   351 RKHLFVQDPQTCKCSCKNTDSRCKARQLELNER------TCRC 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf1NP_523407.1 PDGF 142..223 CDD:278756 22/82 (27%)
VegfaNP_001020421.2 PDGF 227..309 CDD:197537 24/98 (24%)
VEGF_C 343..392 CDD:291235 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.