DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf1 and Pdgfb

DIOPT Version :9

Sequence 1:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_035187.2 Gene:Pdgfb / 18591 MGIID:97528 Length:241 Species:Mus musculus


Alignment Length:216 Identity:50/216 - (23%)
Similarity:87/216 - (40%) Gaps:49/216 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LILPVLLLVLIVSEAAAGSLVSPNNRQPSQRFFYAAATSSSSTQTKVRLLRQADDPSAAPGALEG 81
            |.||:...:.:||  |.|        .|.....|...:..|        :|..||       |:.
Mouse     7 LFLPLCCYLRLVS--AEG--------DPIPEELYEMLSDHS--------IRSFDD-------LQR 46

  Fly    82 SCCQGAAAEAGTPLTLPLSVSAELTNVTADYDVSGEMPSSKENFKRSIMKSTVRNATP---ASCS 143
            ...:.:..|.|..|.|         |:|..:  ||....|....:||:  .::..|.|   |.|.
Mouse    47 LLHRDSVDEDGAELDL---------NMTRAH--SGVELESSSRGRRSL--GSLAAAEPAVIAECK 98

  Fly   144 PQPTIVELKPPAED--EANYYYMPACTRISRCNGCCGSTLISCQPTEVEQVQLRVRKVDRAATSG 206
            .:..:.::.....|  .||:...|.|..:.||:|||.:..:.|:.::|:...::|||::...   
Mouse    99 TRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVR--- 160

  Fly   207 RRPF---TIITVEQHTQCRCD 224
            ::|.   ..:|:|.|..|:|:
Mouse   161 KKPIFKKATVTLEDHLACKCE 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf1NP_523407.1 PDGF 142..223 CDD:278756 21/85 (25%)
PdgfbNP_035187.2 PDGF_N 21..93 CDD:368059 21/107 (20%)
PDGF 97..180 CDD:366040 21/85 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 217..241
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838636
Domainoid 1 1.000 57 1.000 Domainoid score I10843
eggNOG 1 0.900 - - E1_2C4GD
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11633
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1138
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.800

Return to query results.
Submit another query.