DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf1 and Pdgfa

DIOPT Version :9

Sequence 1:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001350200.1 Gene:Pdgfa / 18590 MGIID:97527 Length:211 Species:Mus musculus


Alignment Length:95 Identity:28/95 - (29%)
Similarity:46/95 - (48%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 KSTVRNATPASCSPQPTIVELKPPAED--EANYYYMPACTRISRCNGCCGSTLISCQPTEVEQVQ 193
            |.::..|.||.|..:..|.|:.....|  .||:...|.|..:.||.|||.::.:.|||:.|....
Mouse    85 KRSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRS 149

  Fly   194 LRVRKVDRAATSGRRPFTIITVEQHTQCRC 223
            ::|.||:......:.....:.:|:|.:|.|
Mouse   150 VKVAKVEYVRKKPKLKEVQVRLEEHLECAC 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf1NP_523407.1 PDGF 142..223 CDD:278756 23/82 (28%)
PdgfaNP_001350200.1 PDGF_N 21..95 CDD:398391 3/9 (33%)
PDGF 94..181 CDD:197537 25/86 (29%)
Receptor binding site. /evidence=ECO:0000255 158..162 0/3 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..211
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838637
Domainoid 1 1.000 57 1.000 Domainoid score I10843
eggNOG 1 0.900 - - E1_2C4GD
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6909
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto95032
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11633
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4285
SonicParanoid 1 1.000 - - X1138
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.