DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf1 and Vegfd

DIOPT Version :9

Sequence 1:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_034346.1 Gene:Vegfd / 14205 MGIID:108037 Length:358 Species:Mus musculus


Alignment Length:214 Identity:45/214 - (21%)
Similarity:73/214 - (34%) Gaps:68/214 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 CSPQPTIVELKPPAEDEANYYYMPACTRISRCNGCCGSTLISCQPTEVEQVQLRVRKVDRAATS- 205
            |||:.|.||:........|.::.|.|..:.||.|||....:.|..|....:..::.::....|| 
Mouse   116 CSPRETCVEVASELGKTTNTFFKPPCVNVFRCGGCCNEEGVMCMNTSTSYISKQLFEISVPLTSV 180

  Fly   206 --------------------GRRPFTII-----TVEQ-----------------HTQCRCDCRTK 228
                                .|.|::||     |.|:                 :|:|:|..:.:
Mouse   181 PELVPVKIANHTGCKCLPTGPRHPYSIIRRSIQTPEEDECPHSKKLCPIDMLWDNTKCKCVLQDE 245

  Fly   229 -----AED---------CNVYQSYRKDLCRCECHNTDARDKCLEQAENKYWVDDNCTCV-CR--Y 276
                 .||         |..:.::.:|.|.|.|......| .::..|       ||:|. |:  .
Mouse   246 TPLPGTEDHSYLQEPTLCGPHMTFDEDRCECVCKAPCPGD-LIQHPE-------NCSCFECKESL 302

  Fly   277 NQSCTTGTVFDETQCKCTD 295
            ...|....:|....|.|.|
Mouse   303 ESCCQKHKIFHPDTCSCED 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf1NP_523407.1 PDGF 142..223 CDD:278756 26/123 (21%)
VegfdNP_034346.1 PDGF 114..198 CDD:197537 18/81 (22%)
4 X 16 AA repeats of C-X(10)-C-X-C-X(1,3)-C 227..323 21/103 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.