DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf1 and vegfba

DIOPT Version :9

Sequence 1:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_005157219.2 Gene:vegfba / 101885552 ZFINID:ZDB-GENE-120510-3 Length:246 Species:Danio rerio


Alignment Length:229 Identity:53/229 - (23%)
Similarity:83/229 - (36%) Gaps:77/229 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 SGEMPSSKENFKRSIMKSTVRNATPASCSPQPTIVELKPPAEDEANYYYMPACTRISRCNGCCGS 179
            |||:....:.|:||            .|.|:.|:||:......|.|:.::|:|..:.||.|||..
Zfish    40 SGEVVRWLDVFQRS------------GCHPRETLVEVWQEFPWETNHLFLPSCVTLRRCGGCCSD 92

  Fly   180 TLISCQPTEVEQVQLRVRKVDRAATSGRR------PFTIITVEQHTQCRCDCRTKAEDCNVY--- 235
            ..:.|.|::...:.:.:.|     ||..:      ||.     :|.|  |:||.||   |:|   
Zfish    93 EALECVPSQTHTLVMELMK-----TSYMKHELVQLPFI-----EHNQ--CECRLKA---NLYAEP 142

  Fly   236 -----QSYRKDLCR---------------------------------CECHNTDARDKCLEQAEN 262
                 |:.|:...|                                 .....|.||:.|......
Zfish   143 TRQGPQTTRRGRKRQRGKPKRKKHMGKNSMMLVPTTPPPPPPPTLPPSSAPPTPAREACPPCPIR 207

  Fly   263 KYWV-DDNCTCVCRYNQ-SCT-TGTVFDETQCKC 293
            |... ..:|.|.|...: ||| .|...:::.|:|
Zfish   208 KMTSHPPSCECRCSLREVSCTKRGKTLNQSSCRC 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf1NP_523407.1 PDGF 142..223 CDD:278756 23/86 (27%)
vegfbaXP_005157219.2 PDGF 55..132 CDD:306779 24/88 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10814
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.880

Return to query results.
Submit another query.