DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf1 and pgfa

DIOPT Version :9

Sequence 1:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_021324415.1 Gene:pgfa / 101883508 ZFINID:ZDB-GENE-120928-4 Length:169 Species:Danio rerio


Alignment Length:156 Identity:37/156 - (23%)
Similarity:66/156 - (42%) Gaps:23/156 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 PLTLPLSVSAE---------LTNVTADYDVSGEMPSSKENFKRSIMKSTVRNATPASCSPQPTIV 149
            ||.:.:||...         |..|   :.:.|...|....|:.:..:|..|      |..|...|
Zfish    14 PLDMKISVGVSVLAFLLYLPLIQV---FTILGNSQSKVLLFEEAWARSQCR------CLEQMVYV 69

  Fly   150 ELKPPAEDEANYYYMPACTRISRCNGCCGSTLISCQPTEVEQVQLRVRKVDRAATSGRRPFTIIT 214
            |.:.|...|  :.|.|.|..:.||:|||....::|.|.....:.:::.::..|  ..||.:.:::
Zfish    70 EQEYPGAVE--HIYSPGCVPLLRCSGCCNDEKLACFPVSTSNISIQLLRITPA--ERRRDYVLLS 130

  Fly   215 VEQHTQCRCDCRTKAEDCNVYQSYRK 240
            .::|..|.|..| |.:..:.::..||
Zfish   131 FQEHQSCECRPR-KHQQRHQHKRRRK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf1NP_523407.1 PDGF 142..223 CDD:278756 21/80 (26%)
pgfaXP_021324415.1 PDGF 58..141 CDD:197537 24/92 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10814
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.