DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf1 and pdgfb

DIOPT Version :9

Sequence 1:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001297028.1 Gene:pdgfb / 100492827 XenbaseID:XB-GENE-487583 Length:240 Species:Xenopus tropicalis


Alignment Length:173 Identity:41/173 - (23%)
Similarity:66/173 - (38%) Gaps:26/173 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GALEGSCCQGAAAEAGTPLTLPL----------SVSAELTNVTADYDVSGE-------------M 118
            |.|...|...|.:..|.|:...:          |:| ||..|.....|..|             .
 Frog     5 GLLVSLCLLLAVSAEGDPIPEEMFKKISEGAVTSIS-ELRRVLQIDSVDDEDDLNYASIHQTRSS 68

  Fly   119 PSSKENFKRSIMKSTVRNATPASCSPQPTIVELKPPAED--EANYYYMPACTRISRCNGCCGSTL 181
            |::..:..|.|.......|..|.|.|:..:.|:.....|  .||:...|.|..:.||:|||.|..
 Frog    69 PTNSSSHSRVIRSLDAEKAVIAECKPRVEVFEISRKIVDPTNANFLVWPPCVEVQRCSGCCNSKN 133

  Fly   182 ISCQPTEVEQVQLRVRKVDRAATSGRRPFTIITVEQHTQCRCD 224
            :.|.||.:....::|.|:.......::...::.:|.|..|:|:
 Frog   134 MRCAPTRIHVRHVQVNKIFITPKGKKQVKVVVPLEDHHDCKCE 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf1NP_523407.1 PDGF 142..223 CDD:278756 22/82 (27%)
pdgfbNP_001297028.1 PDGF_N 19..90 CDD:368059 13/71 (18%)
PDGF 92..175 CDD:366040 22/82 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10601
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm49358
Panther 1 1.100 - - O PTHR11633
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1138
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.