DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf1 and vegfc

DIOPT Version :9

Sequence 1:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_002933363.1 Gene:vegfc / 100487606 XenbaseID:XB-GENE-484533 Length:407 Species:Xenopus tropicalis


Alignment Length:227 Identity:54/227 - (23%)
Similarity:78/227 - (34%) Gaps:49/227 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 YDVSGE----MPSSKENFKRSIMKSTVRNATPASCSPQPTIVELKPPAEDEANYYYMPACTRISR 172
            ||...|    ..::..|:...|.||.........|.|:...|::........|.::.|.|..:.|
 Frog    83 YDTRREDSFTFAAAHYNYNAEIWKSIENEWRKTQCIPREVCVDVGKEFGAPTNTFFKPPCVSVYR 147

  Fly   173 CNGCCGSTLISCQPTEVEQVQLRVRKVDRAATSGR-RPFTIITVEQHTQCRC------------- 223
            |.|||.|..:.|..|....|...:.::....:.|. :|.| |:...||.|||             
 Frog   148 CGGCCNSEGLHCMNTSSTFVSKTLFEITVPLSQGPVKPVT-ISFANHTSCRCMSKLDVYRQVHSI 211

  Fly   224 ----------DCRTKAEDCNVYQSYRKDLCRC-------------ECHNTDA-RDKCLEQAENKY 264
                      .|:...:.|.....:...:|||             |..|.:| .|.|   ..||.
 Frog   212 IRRSLPATQLQCQVANKTCPRNHIWNNHVCRCIMQHDVEFSPSPEEEDNEEAFNDIC---GPNKE 273

  Fly   265 WVDDNCTCVCR---YNQSCTTGTVFDETQCKC 293
            ..::.|.|||:   ...||......|.|.|||
 Frog   274 LDEETCQCVCKGGLVPSSCGPQKELDRTSCKC 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf1NP_523407.1 PDGF 142..223 CDD:278756 22/81 (27%)
vegfcXP_002933363.1 PDGF 115..200 CDD:197537 24/85 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1364454at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.