DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pvf1 and pdgfa

DIOPT Version :9

Sequence 1:NP_523407.1 Gene:Pvf1 / 32876 FlyBaseID:FBgn0030964 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_031748295.1 Gene:pdgfa / 100038202 XenbaseID:XB-GENE-484495 Length:225 Species:Xenopus tropicalis


Alignment Length:189 Identity:47/189 - (24%)
Similarity:78/189 - (41%) Gaps:37/189 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 CCQ-----GAAAEAGTPLTLPLSVS-----------AELTNVTADYDVSG-EMPSSKENF----- 125
            ||.     |..||....|...|:.|           .::.:|....|.|| .:.|...:|     
 Frog    13 CCYLSPSLGEEAEIPQELIERLAHSEIRSISDLQRLLDIDSVGGGEDASGANIRSQTRDFRHNRL 77

  Fly   126 ---KRSI---MKSTVRNATPASCSPQPTIVELKPPAED--EANYYYMPACTRISRCNGCCGSTLI 182
               |||:   .|.:|..|.||.|..:..|.|:.....|  .||:...|.|..:.||.|||.::.:
 Frog    78 VPEKRSVPSRRKRSVEEAVPAICKTRTVIYEIPRSKIDSTSANFLIWPPCVEVKRCTGCCNTSSV 142

  Fly   183 SCQPTEVEQVQLRVRKVDRAATSGRRPFTIITVEQHTQCRCDCRTKAEDCNVYQSYRKD 241
            .|||:.:....::|.||:......:....::.:|:|.:|.|...:.::       ||::
 Frog   143 KCQPSRIHHRSVKVAKVEYVRKKPKLKEVLVQLEEHLECTCTANSNSD-------YREE 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pvf1NP_523407.1 PDGF 142..223 CDD:278756 22/82 (27%)
pdgfaXP_031748295.1 PDGF_N 22..99 CDD:398391 18/76 (24%)
PDGF 98..183 CDD:197537 23/84 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10601
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm49358
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4285
SonicParanoid 1 1.000 - - X1138
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.