Sequence 1: | NP_573329.2 | Gene: | CG7101 / 32875 | FlyBaseID: | FBgn0030963 | Length: | 352 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001291292.1 | Gene: | ZBTB26 / 57684 | HGNCID: | 23383 | Length: | 441 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 52/206 - (25%) |
---|---|---|---|
Similarity: | 80/206 - (38%) | Gaps: | 58/206 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 144 AEEVHRLRTLKSTASDADSQVDEMEDLEMLEENIENILPSIDWDDDLTFGWPTDLDKESCIVNAK 208
Fly 209 PSVF---------------VCPFCANGFPGSLSLVRHLE------QVHERSALDCCYCGKSHGSR 252
Fly 253 EALRSHLQRVHILLRGHVCGICQADFATADHLKKHVNSLHLDHRPHLCPTCGKRFTQRCHLTDHI 317
Fly 318 KTDRGHGHGTY 328 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7101 | NP_573329.2 | PHA00733 | <210..263 | CDD:177301 | 18/73 (25%) |
C2H2 Zn finger | 242..263 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 271..292 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 300..319 | CDD:275368 | 5/18 (28%) | ||
C2H2 Zn finger | 330..347 | CDD:275368 | |||
ZBTB26 | NP_001291292.1 | BTB_POZ_ZBTB26_Bioref | 8..129 | CDD:349523 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 134..177 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 194..216 | 0/1 (0%) | |||
COG5236 | <269..>381 | CDD:227561 | 37/124 (30%) | ||
C2H2 Zn finger | 275..295 | CDD:275368 | 8/26 (31%) | ||
zf-C2H2 | 298..320 | CDD:395048 | 7/22 (32%) | ||
C2H2 Zn finger | 300..320 | CDD:275368 | 7/20 (35%) | ||
zf-H2C2_2 | 315..337 | CDD:404364 | 8/22 (36%) | ||
C2H2 Zn finger | 328..348 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 356..374 | CDD:275368 | 5/17 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |