DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7101 and ZBTB26

DIOPT Version :9

Sequence 1:NP_573329.2 Gene:CG7101 / 32875 FlyBaseID:FBgn0030963 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001291292.1 Gene:ZBTB26 / 57684 HGNCID:23383 Length:441 Species:Homo sapiens


Alignment Length:206 Identity:52/206 - (25%)
Similarity:80/206 - (38%) Gaps:58/206 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 AEEVHRLRTLKSTASDADSQVDEMEDLEMLEENIENILPSIDWDDDLTFGWPTDLDKESCIVNAK 208
            :|..|.|  :.||   .:::|.|:|     :.::.|...|....|:              |:.|.
Human   214 SEPQHSL--INST---VENRVSEIE-----QNHLHNYALSYTGSDN--------------IIMAS 254

  Fly   209 PSVF---------------VCPFCANGFPGSLSLVRHLE------QVHERSALDCCYCGKSHGSR 252
            ..||               .||.|...|       ||||      ::|:  ...|..|||:...:
Human   255 KDVFGPNIRGVDKGLQWHHQCPKCTRVF-------RHLENYANHLKMHK--LFMCLLCGKTFTQK 310

  Fly   253 EALRSHLQRVHILLRGHVCGICQADFATADHLKKHVNSLHLDHRPHLCPTCGKRFTQRCHLTDHI 317
            ..|..|: |||..::...|.||...|:....|:.|:| ||...:||.|..|...|..:..|..|:
Human   311 GNLHRHM-RVHAGIKPFQCKICGKTFSQKCSLQDHLN-LHSGDKPHKCNYCDMVFAHKPVLRKHL 373

  Fly   318 KTDRGHGHGTY 328
            |  :.||..::
Human   374 K--QLHGKNSF 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7101NP_573329.2 PHA00733 <210..263 CDD:177301 18/73 (25%)
C2H2 Zn finger 242..263 CDD:275368 7/20 (35%)
C2H2 Zn finger 271..292 CDD:275368 7/20 (35%)
C2H2 Zn finger 300..319 CDD:275368 5/18 (28%)
C2H2 Zn finger 330..347 CDD:275368
ZBTB26NP_001291292.1 BTB_POZ_ZBTB26_Bioref 8..129 CDD:349523
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..177
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..216 0/1 (0%)
COG5236 <269..>381 CDD:227561 37/124 (30%)
C2H2 Zn finger 275..295 CDD:275368 8/26 (31%)
zf-C2H2 298..320 CDD:395048 7/22 (32%)
C2H2 Zn finger 300..320 CDD:275368 7/20 (35%)
zf-H2C2_2 315..337 CDD:404364 8/22 (36%)
C2H2 Zn finger 328..348 CDD:275368 7/20 (35%)
C2H2 Zn finger 356..374 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.