DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7101 and pzg

DIOPT Version :9

Sequence 1:NP_573329.2 Gene:CG7101 / 32875 FlyBaseID:FBgn0030963 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001262143.1 Gene:pzg / 40351 FlyBaseID:FBgn0259785 Length:996 Species:Drosophila melanogaster


Alignment Length:361 Identity:71/361 - (19%)
Similarity:106/361 - (29%) Gaps:151/361 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 FLCLQCGKKYASATFLYRHVASWHGQQSLFYCDMCTDNCNDVKTFSGMLELQEHAEEVHRLRT-- 152
            ||.:.||:.|.                    |..||:..|    :...||     .:|.|::|  
  Fly   120 FLVIVCGEDYV--------------------CSRCTNLVN----YYDRLE-----NDVERVKTNL 155

  Fly   153 ----LKSTASDADSQVDEMEDLEM-----------LEENIENILPSIDW--DDDLTFGWPTDLDK 200
                .|..|.:.|...:....|:|           |||:     ||.|.  ...|..|.|....|
  Fly   156 ISLLNKKYAINEDMGQEGSPPLKMQKMVGGSANRSLEES-----PSADLLRPRKLLQGNPVGQSK 215

  Fly   201 -------------------------------------------ESCIVNAKPSVFVCPFCANGFP 222
                                                       |:|    |...|.|..|...||
  Fly   216 IAPGTTQSSVQGTQTVQRKATKIYKCTSCDYKTSDMRLFNTHYETC----KQQTFQCKTCRKIFP 276

  Fly   223 GSLSLVRHLEQVHERSALD--CCYCGKSHGSREALRSHLQRVH---ILLRG-------------- 268
            ...::.:|:.:.| .:|:|  |..|..:..:..:||.|::..|   :|:..              
  Fly   277 HFGAMKQHMVRDH-NTAMDNTCAMCHINFVNENSLRKHMETNHATNVLVTSTTTIPASAAPVAAA 340

  Fly   269 -----------------HVCGICQADFATAD------HLKKHVNSLHLDHRPHLCPTCGKRFTQR 310
                             :.|..||  |.:.|      |::||...   ..:|..|..|.:||..|
  Fly   341 AAAAAAAANENLVGTSLYTCNHCQ--FKSTDKVVFDEHMRKHAAG---KPKPFKCRLCSQRFETR 400

  Fly   311 CHLTDHIKTDRGHGHGTYTCEFCVRPFFRAIDLERH 346
            ...|.|.|.   |....:.|..|...|.:...|.:|
  Fly   401 EAATVHAKQ---HQTNFFKCGTCSMTFPKREMLVKH 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7101NP_573329.2 PHA00733 <210..263 CDD:177301 14/54 (26%)
C2H2 Zn finger 242..263 CDD:275368 5/20 (25%)
C2H2 Zn finger 271..292 CDD:275368 8/26 (31%)
C2H2 Zn finger 300..319 CDD:275368 7/18 (39%)
C2H2 Zn finger 330..347 CDD:275368 5/17 (29%)
pzgNP_001262143.1 C2H2 Zn finger 241..263 CDD:275371 2/25 (8%)
C2H2 Zn finger 268..289 CDD:275371 5/20 (25%)
C2H2 Zn finger 297..318 CDD:275371 5/20 (25%)
C2H2 Zn finger 360..380 CDD:275368 6/21 (29%)
zf-H2C2_2 373..399 CDD:290200 8/28 (29%)
zf-C2H2_8 375..443 CDD:292531 18/65 (28%)
C2H2 Zn finger 390..410 CDD:275368 8/22 (36%)
C2H2 Zn finger 417..437 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455503
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3134
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.880

Return to query results.
Submit another query.