DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7101 and CG2199

DIOPT Version :9

Sequence 1:NP_573329.2 Gene:CG7101 / 32875 FlyBaseID:FBgn0030963 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_728599.1 Gene:CG2199 / 38159 FlyBaseID:FBgn0035213 Length:733 Species:Drosophila melanogaster


Alignment Length:305 Identity:69/305 - (22%)
Similarity:108/305 - (35%) Gaps:86/305 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LTLFGE------EARLERHRERKHNDG-------QFLCLQCGKKYASATFLYR-HVASWHGQQ-- 116
            |.|||.      |...|...|...:.|       .|.|.:| :.:|.....|: |:...||.|  
  Fly   193 LNLFGNGGNDAIEVLTESEEEEDSDKGPITINTNNFQCPEC-EFHAKFPKPYKEHLQKEHGLQRP 256

  Fly   117 SLFYCDMCTDNCNDVKTFSGMLELQEHAEEVHRLRTLKSTA-------------SDADSQVD--- 165
            .::.|.:|      :|||..:..|:.|..:.|. ||.:|.|             |.|.:::|   
  Fly   257 RIYPCTLC------IKTFGVLKTLKNHLRDTHS-RTFESEAKTKAKESKEKEAKSGAKNKIDAKA 314

  Fly   166 -------------EMEDLEMLEE---NIE-NILPSIDWDDDLTFGWPTDLDKESCIVNAKPSVFV 213
                         |.:..|...|   |:| .::..|  ||.:.....||.:........|.:.| 
  Fly   315 KETNAVSQRKKPKEKKSKEKKTEIKCNVETKVVDEI--DDQVNNKKGTDSEDADQTQATKIASF- 376

  Fly   214 CPFCANGFPGSLSLVRHLEQVHERSALDCCYC----GKSHGSREALRSHLQRVHILLRGHVCGIC 274
                 .....||...|.||.|     :|..|.    |.|..:..|..::.|          |.||
  Fly   377 -----KALNESLMKKRMLENV-----IDSEYTFAINGSSASTPRADSNNFQ----------CEIC 421

  Fly   275 QADFATADHLKKHVNSLHLDHRPHL--CPTCGKRFTQRCHLTDHI 317
            ..:..||..:::|:.::|...:|.:  |..|.|....:..|..|:
  Fly   422 DCELMTAKQMQEHMKTVHSIDKPKVFKCHVCEKSLATKQSLKTHM 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7101NP_573329.2 PHA00733 <210..263 CDD:177301 13/56 (23%)
C2H2 Zn finger 242..263 CDD:275368 5/24 (21%)
C2H2 Zn finger 271..292 CDD:275368 6/20 (30%)
C2H2 Zn finger 300..319 CDD:275368 5/18 (28%)
C2H2 Zn finger 330..347 CDD:275368
CG2199NP_728599.1 C2H2 Zn finger 418..439 CDD:275370 6/20 (30%)
C2H2 Zn finger 449..469 CDD:275370 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440040
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.