DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7101 and CG8089

DIOPT Version :9

Sequence 1:NP_573329.2 Gene:CG7101 / 32875 FlyBaseID:FBgn0030963 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster


Alignment Length:273 Identity:71/273 - (26%)
Similarity:105/273 - (38%) Gaps:45/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 HGQQSLFYCDMCTDNCNDVKTFSGMLELQEH-------AEEVHRLRTLKSTASDADSQVDEMEDL 170
            |.....|:|.:|      .:.|.....|..|       :.|:|..:..|....:..||  |.::|
  Fly   192 HRYSDNFHCQIC------YRRFYLQHSLTSHIIRKSTSSRELHENKRYKRLLENQKSQ--EEKEL 248

  Fly   171 EMLEENIENILPSIDWDDDLTFGWPTDLDKESCIVNAKPSVFVCPFCAN----GFPGSLSLVRH- 230
            |:....:|:||..:..|....|   .|..|.........|:..||.||.    .|...|.:|:| 
  Fly   249 ELSLNKVEDILVPVAEDLQSYF---KDESKHPIQKRKTSSLSKCPSCAQNYGFSFSHQLHMVKHR 310

  Fly   231 LEQVHERSALDCCYCGKSHGSREALRSHLQRVH----ILLRGHVCGICQADFATADHLKKHVNSL 291
            .|:::......|.:|.:|..:|:.||.|.|||.    :|.|...|..|...|.....|..||..:
  Fly   311 RERLYTNFPFHCSFCNRSFLTRKFLRKHQQRVRTFSTLLYRPFKCPHCTWRFQLKSALDSHVLRI 375

  Fly   292 HLDHRPHL-C--PT----CGKRFTQRCH-----LTDHIKTDRGHGHG------TYTCEFCVRPFF 338
            |...:|.| |  ||    |....::.|:     ..|.::..|....|      |..|:.|.|.|.
  Fly   376 HERRKPCLICKLPTSRLCCSAHTSKECNRAMQKYRDKMRPLREPPKGGCRKQPTPVCKICNRKFT 440

  Fly   339 RAIDLERHVCEEH 351
            |...||.|:.:.|
  Fly   441 RKFFLEEHMNKAH 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7101NP_573329.2 PHA00733 <210..263 CDD:177301 19/57 (33%)
C2H2 Zn finger 242..263 CDD:275368 9/20 (45%)
C2H2 Zn finger 271..292 CDD:275368 6/20 (30%)
C2H2 Zn finger 300..319 CDD:275368 6/29 (21%)
C2H2 Zn finger 330..347 CDD:275368 7/16 (44%)
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368 7/19 (37%)
C2H2 Zn finger 322..343 CDD:275368 9/20 (45%)
C2H2 Zn finger 355..376 CDD:275368 6/20 (30%)
C2H2 Zn finger 432..453 CDD:275368 8/20 (40%)
C2H2 Zn finger 461..486 CDD:275368
C2H2 Zn finger 490..506 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455499
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.