DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7101 and CG12942

DIOPT Version :9

Sequence 1:NP_573329.2 Gene:CG7101 / 32875 FlyBaseID:FBgn0030963 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_610628.2 Gene:CG12942 / 36158 FlyBaseID:FBgn0033569 Length:686 Species:Drosophila melanogaster


Alignment Length:327 Identity:69/327 - (21%)
Similarity:109/327 - (33%) Gaps:85/327 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KKRTYHCGVC-------FAEFSRHLAAKRH------EQQCSVRVRRLFVCPHCLTLFGEEARLER 79
            |.:.:.|..|       .:|..:|| ...|      |..|.::..    ||.|..:|.::....:
  Fly   341 KNQNFKCRPCNSYETKDRSEMQKHL-IDHHKIDGDFEMYCYMQAN----CPACDRIFKDQRSARK 400

  Fly    80 HRERKHNDGQ--------FLCLQCGKKYASATFLYRHVASWHGQQ------SLFYCDMCTDNCND 130
            |..|.|...|        :.|..|.|       ::...||.|..|      .:.:|..|....|.
  Fly   401 HYTRVHTPVQIAVSPTESYACTACDK-------VFNQKASLHSHQRFCQVKDVVHCSFCDQQFNS 458

  Fly   131 VKTFSGMLELQE-HA-EEVHRLRTLKSTASDADSQVDEMEDLEMLEENIENILPSIDWDDDLTFG 193
            ::.:.  |.||: || |.||.....:.:...|::                           ||..
  Fly   459 MRKYE--LHLQQLHAVETVHECEICRRSFKSAET---------------------------LTMH 494

  Fly   194 WPTDLDKESCIVNAKPSVFVCPFCANGFPGSLSLVRHLEQVH-ERSALDCCYCGKSHGSREALRS 257
            .....::.          :.|..|:..:..|..|..|.|:.| ....:.|..||....:...||.
  Fly   495 RKRHSERH----------YQCGKCSLNYVNSAELRVHYERAHVNEEPVSCLTCGNQFQNMTLLRE 549

  Fly   258 HLQRVHILLRGHVCGICQADFATADHLKKHVNSLHLDHRPHLCPTCGKRFTQRCHLTDHIKTDRG 322
            |.||.|...:...|.:|..:..|....::|... |:|: |:.|..|...|..|.....|.|  :.
  Fly   550 HEQRSHQKSKVWRCEVCNFETKTRWRRRQHQYE-HMDY-PYKCQKCTSEFADRSKFRQHSK--KV 610

  Fly   323 HG 324
            ||
  Fly   611 HG 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7101NP_573329.2 PHA00733 <210..263 CDD:177301 15/53 (28%)
C2H2 Zn finger 242..263 CDD:275368 8/20 (40%)
C2H2 Zn finger 271..292 CDD:275368 4/20 (20%)
C2H2 Zn finger 300..319 CDD:275368 5/18 (28%)
C2H2 Zn finger 330..347 CDD:275368
CG12942NP_610628.2 zf-AD 22..101 CDD:285071
C2H2 Zn finger 385..406 CDD:275368 6/20 (30%)
C2H2 Zn finger 421..470 CDD:275368 13/57 (23%)
C2H2 Zn finger 449..466 CDD:275371 4/18 (22%)
C2H2 Zn finger 478..498 CDD:275368 3/46 (7%)
C2H2 Zn finger 505..526 CDD:275368 6/20 (30%)
C2H2 Zn finger 534..555 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440070
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.