DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7101 and CG18011

DIOPT Version :9

Sequence 1:NP_573329.2 Gene:CG7101 / 32875 FlyBaseID:FBgn0030963 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_610559.1 Gene:CG18011 / 36068 FlyBaseID:FBgn0033491 Length:985 Species:Drosophila melanogaster


Alignment Length:417 Identity:90/417 - (21%)
Similarity:138/417 - (33%) Gaps:143/417 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CGVCFAEFS----------RHLAAKRHEQQCSV------------------------------RV 58
            |.:|..||:          :||..::....||.                              .:
  Fly   545 CELCSREFATEATYNIHMKKHLIIEKDVHVCSTCGLLSDSRETLLAHVNSVKTACFGSKIDVELL 609

  Fly    59 RRLFVCPHCLTLFGEEARLERHRER-KHNDGQFLCLQCGKKYASATFLYRH---------VASWH 113
            |..:||.:|.:.|.|:..|:.||:. .|.||.|||..|||::.... ||||         ..|.|
  Fly   610 RDAYVCEYCSSYFKEKDCLQAHRDSGVHKDGVFLCQPCGKEFPHMK-LYRHHLRNYQQLRSDSTH 673

  Fly   114 GQQSL---FYCDM--CTD---NCNDVKTFSGMLELQEHAEEVHRLRTLKSTASDADSQVDEMEDL 170
            .:..:   :.||.  ||:   |.|.:.|              |:.||.:|.:..|:......:: 
  Fly   674 RRLEICVYYMCDQENCTESYVNWNSLYT--------------HKRRTHESASKQAEKSSKSAQE- 723

  Fly   171 EMLEENIENILPSIDWDDDLTFGWPTDLDKESCIVNAKPSVFV----------CPFCANGFPGSL 225
                                   |......:.|......||.|          ||.|.:.:....
  Fly   724 -----------------------WVCQFCLKECRSKMSLSVHVARSHNNDNVTCPLCNSSYKSHD 765

  Fly   226 SLVRHLEQVHERSALDCCYCGKSHGSREALRSHLQRVHILLRGHVCGICQADFATADHLKKHVNS 290
            :|.:|....||  .::|..|.|...:|....:|:..||...:.:.|.:||..|.....::.| ..
  Fly   766 ALAKHHAYWHE--PIECPECFKIVKNRRNYDTHVNVVHSNKKRYSCSVCQKGFYHKSEMEAH-QK 827

  Fly   291 LHLDHRPHLCPTCG------------------KRFTQRCHL-------TDHIKTDRGHGHG-TYT 329
            ||  .:.:.|..|.                  |||...|::       :..:||.....|| .||
  Fly   828 LH--GQSYSCEQCSFTTRNKKSLSVHVLGQHYKRFAFECNVCKKRFGRSQGLKTHMQRAHGDKYT 890

  Fly   330 CE-----FCVRPFFRAIDLERHVCEEH 351
            |.     .|.|.|..:..|..||.:.|
  Fly   891 CRDYFDGGCGRTFVNSSQLNVHVRKIH 917

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7101NP_573329.2 PHA00733 <210..263 CDD:177301 15/62 (24%)
C2H2 Zn finger 242..263 CDD:275368 5/20 (25%)
C2H2 Zn finger 271..292 CDD:275368 5/20 (25%)
C2H2 Zn finger 300..319 CDD:275368 6/43 (14%)
C2H2 Zn finger 330..347 CDD:275368 5/21 (24%)
CG18011NP_610559.1 PRK14950 <98..>184 CDD:237864
C2H2 Zn finger 488..508 CDD:275368
C2H2 Zn finger 518..538 CDD:275368
C2H2 Zn finger 545..565 CDD:275368 4/19 (21%)
C2H2 Zn finger 575..596 CDD:275371 2/20 (10%)
SFP1 <682..747 CDD:227516 17/102 (17%)
C2H2 Zn finger 754..775 CDD:275368 5/20 (25%)
C2H2 Zn finger 780..801 CDD:275368 5/20 (25%)
C2H2 Zn finger 809..829 CDD:275368 5/20 (25%)
C2H2 Zn finger 864..885 CDD:275368 3/20 (15%)
C2H2 Zn finger 891..917 CDD:275368 7/25 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440071
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.