DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7101 and CG10631

DIOPT Version :9

Sequence 1:NP_573329.2 Gene:CG7101 / 32875 FlyBaseID:FBgn0030963 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_609998.1 Gene:CG10631 / 35262 FlyBaseID:FBgn0032817 Length:3781 Species:Drosophila melanogaster


Alignment Length:340 Identity:77/340 - (22%)
Similarity:113/340 - (33%) Gaps:89/340 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SNRG--ALPLAAKKPA---KKRTY-------HCGV---------CFAEFSRHLAAKRHEQQCSVR 57
            |:||  :||:..:...   ||:.|       :||:         |...|......:||  :...|
  Fly   278 SDRGNESLPICQRCKEVFFKKQVYLRHVAESNCGIQEYDFKCSTCPMSFMTTEELQRH--KLHHR 340

  Fly    58 VRRLFVCPHCLTLFGEEARLERHRERKHNDGQFLCLQCGKKYASATFLYRHVASWHGQQSLFYCD 122
            ..|.|...:|...|...|..|.|...:|....|:|..|...:|:...||.|:.. |..|..|.|.
  Fly   341 ADRFFCHKYCGKHFDTIAECEAHEYMQHEYDSFVCNMCSGTFATREQLYAHLPQ-HKFQQRFDCP 404

  Fly   123 MCTDNCNDVKTFSGMLELQEHAEEVHRLRT-----------LKSTASDADSQVDE---------M 167
            :|.      ..:...|||.|     |||..           ..|:||.:.:|..:         |
  Fly   405 ICR------LWYQTALELHE-----HRLAAPYFCGKYYTGGQSSSASQSQAQQHQTNYKLQDCHM 458

  Fly   168 EDLEMLEENIENILPSIDWDDDLTFGWPTDLDKESCI----VNAKPSVFVCPFCANGFPGSLSLV 228
            ..:||.........||       ....|......|.:    .||..:..   |.|:.....::: 
  Fly   459 ATMEMPTTPHHKTTPS-------GSSLPATAALNSLLQQRQANADGAAM---FAASAMKNEVNV- 512

  Fly   229 RHLEQVHERSALDCCYCGKSHGSREALRSHLQRVHILLRGHVCGICQADFATADHLKKHVNSLHL 293
             .:|:.:..|..:..|..:..|...|..|. ..:|   .|.:.| .||..:|.|           
  Fly   513 -KMERSYSNSTSESSYSVQDSGYNNAYGSD-SSMH---AGAIAG-PQAHSSTLD----------- 560

  Fly   294 DHRPHLC--PTCGKR 306
            |....||  |.||.|
  Fly   561 DSEDALCCVPLCGVR 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7101NP_573329.2 PHA00733 <210..263 CDD:177301 8/52 (15%)
C2H2 Zn finger 242..263 CDD:275368 4/20 (20%)
C2H2 Zn finger 271..292 CDD:275368 5/20 (25%)
C2H2 Zn finger 300..319 CDD:275368 5/9 (56%)
C2H2 Zn finger 330..347 CDD:275368
CG10631NP_609998.1 C2H2 Zn finger 288..311 CDD:275368 3/22 (14%)
C2H2 Zn finger 319..339 CDD:275368 4/21 (19%)
DM3 584..642 CDD:128933
DM3 683..738 CDD:128933
DM3 775..832 CDD:128933
DM3 945..1000 CDD:128933
DM3 1038..1096 CDD:128933
DM3 1145..1198 CDD:128933
THAP 1236..1308 CDD:214951
DM3 1349..1406 CDD:128933
THAP 1424..1493 CDD:214951
DM3 1538..1596 CDD:128933
DM3 1683..1739 CDD:128933
DM3 1778..1831 CDD:128933
DM3 1980..2033 CDD:128933
DM3 2147..2202 CDD:128933
DM3 2308..2365 CDD:128933
DM3 2434..2491 CDD:128933
DM3 2539..2598 CDD:128933
DM3 2622..2680 CDD:128933
DM3 2718..2775 CDD:128933
DM3 2907..2965 CDD:128933
DM3 3098..3155 CDD:128933
DM3 3227..3284 CDD:128933
DM3 3396..3452 CDD:128933
DM3 3544..3601 CDD:128933
THAP 3621..>3669 CDD:283206
DM3 3690..3748 CDD:128933
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3134
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.