DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7101 and zf30C

DIOPT Version :9

Sequence 1:NP_573329.2 Gene:CG7101 / 32875 FlyBaseID:FBgn0030963 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_477301.1 Gene:zf30C / 34292 FlyBaseID:FBgn0270924 Length:777 Species:Drosophila melanogaster


Alignment Length:405 Identity:78/405 - (19%)
Similarity:128/405 - (31%) Gaps:121/405 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EPVPI---------RPKAPGASNRGALPLAAKKPAKK-------------RTYHCGVCF------ 38
            |.:|:         .|::|...:....|....|.:||             :::.|..|.      
  Fly   351 EKIPVVKRKYRKRNAPRSPSPDDSSGTPKRVAKISKKELKERLKMINKMEKSWKCPHCVKIYHIR 415

  Fly    39 AEFSRHLAAKRHEQQCSVRV------------RRLFVCPHCLTLFGEEARLERHRERKHNDGQ-- 89
            ..:.:||.......:..::.            ..:|.||.|..::..|.||..|.:....||:  
  Fly   416 KPYEKHLRDDHKLNEAEMKEIFKDVDVHAKLDEEVFKCPICSKIYLVEKRLVTHMKVHGEDGKLT 480

  Fly    90 FLC-LQCGKKYASATFLYRHVASWHGQQSLFYCDMCTDNCNDVKTFSGMLELQEHAEEVHRLRTL 153
            |.| ..|...:|:......|..:.|  :.|.||:.|.      |..:|...|:.|....|..:..
  Fly   481 FKCPCYCNLFFATKEQATEHARAQH--KELLYCEKCD------KYMTGHDSLKNHERNFHSKKEP 537

  Fly   154 KSTASDADSQVDEMEDLEMLEENIENILPSIDWDDDLTFGWPTDLDKESCIVNAKPSVFVCPFCA 218
            :|.                 :.|:                                   :|..|.
  Fly   538 RSQ-----------------QRNL-----------------------------------ICDKCG 550

  Fly   219 NGFPGSLSLVRHLEQVHERSAL-DCCYCGKSHGSREALRSHLQRVHILLRGHVCGICQADFATAD 282
            ..|.|..||..|:.....|..| .|..|||...:...|::|: .:|.....:.|..|...|....
  Fly   551 KKFTGRTSLSDHVRSDCGRLPLYGCSVCGKHLSTAGILKTHM-LLHKADTPYQCDKCGKTFKVKA 614

  Fly   283 HLKKHVNSLHLDHRPHLCPTCGKRFTQR----CHLTDHIKTDRGHGHGTYTCEFCVRPFFRAIDL 343
            ..|.|:.:.|.|::|:.|..|.|.:..|    .|:|.|....|      :.|..|.:.|....:|
  Fly   615 QYKSHLKTRHTDYKPYKCHLCPKEYPYRESLLTHMTVHTGIKR------FLCNNCGKRFTCISNL 673

  Fly   344 ERH------VCEEHP 352
            :.|      .|.:.|
  Fly   674 QAHRKVHADTCGQLP 688

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7101NP_573329.2 PHA00733 <210..263 CDD:177301 15/53 (28%)
C2H2 Zn finger 242..263 CDD:275368 6/20 (30%)
C2H2 Zn finger 271..292 CDD:275368 5/20 (25%)
C2H2 Zn finger 300..319 CDD:275368 7/22 (32%)
C2H2 Zn finger 330..347 CDD:275368 5/22 (23%)
zf30CNP_477301.1 C2H2 Zn finger 33..53 CDD:275368
C2H2 Zn finger 61..82 CDD:275368
C2H2 Zn finger 98..117 CDD:275368
C2H2 Zn finger 134..152 CDD:275368
C2H2 Zn finger 511..532 CDD:275370 6/26 (23%)
COG5048 <523..>672 CDD:227381 40/207 (19%)
C2H2 Zn finger 546..566 CDD:275368 7/19 (37%)
C2H2 Zn finger 575..595 CDD:275368 6/20 (30%)
C2H2 Zn finger 603..624 CDD:275368 5/20 (25%)
C2H2 Zn finger 632..652 CDD:275368 6/19 (32%)
C2H2 Zn finger 660..680 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455501
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.