DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7101 and CG8944

DIOPT Version :9

Sequence 1:NP_573329.2 Gene:CG7101 / 32875 FlyBaseID:FBgn0030963 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_573065.1 Gene:CG8944 / 32517 FlyBaseID:FBgn0030680 Length:762 Species:Drosophila melanogaster


Alignment Length:314 Identity:73/314 - (23%)
Similarity:106/314 - (33%) Gaps:80/314 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LPLAAKKPAKKRTYHCGVCFAEFSRHLAAKRHEQQCSVRVRRL-FVCPHCLTLFGEEARLERHRE 82
            |.:...:|:....|:|.:|..:|........|:|.....|..: |.|..|...|.|:|..:.|. 
  Fly   491 LHMLTHQPSLGGGYYCNICSIQFHNAQEFDNHKQLHLGGVTEIKFNCELCTASFREKANYDEHL- 554

  Fly    83 RKHNDGQFLCLQCGKKYASATFLYRHVASWHGQQSLFYCDMCTDNC---NDVKTFSGMLELQEHA 144
            |:||:..||          .:....|        |:....:..|..   .:....||....:.||
  Fly   555 RRHNEELFL----------PSLALNH--------SIMEGGLGDDEIGVEGEESRGSGSRRKRRHA 601

  Fly   145 EEVHRLRTLKSTASDADSQVDEMEDLEMLEENIENILPSIDWDDDL--------TFGWPTDLDKE 201
                        |...|..||                     |||.        :.|..||:   
  Fly   602 ------------AKATDDMVD---------------------DDDRIGGGGGGGSGGGGTDI--- 630

  Fly   202 SCIVNAKPSVFVCPFCANGF--PGSLSLVRHLEQVHERSALDCCY--CGKSHGSREALRSHLQRV 262
                 |||  :.|..|...|  ||.|:..|.:.|........|.|  |.||..:|.:|..||:: 
  Fly   631 -----AKP--YGCDVCRRSFATPGHLNAHRIVHQDERERCYKCDYPQCNKSFVARNSLFEHLKQ- 687

  Fly   263 HILLRGHVCGICQADFATADHLKKHVNSLHLDHRPHLCPTCGKRFTQRCHLTDH 316
            |.......|.||...|.:..:|:.| ..:|...:.::|..||..|.|...|..|
  Fly   688 HYSNEEFKCDICGKTFKSTKNLQNH-KQIHDKIKRYVCQICGSAFAQAAGLYLH 740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7101NP_573329.2 PHA00733 <210..263 CDD:177301 17/56 (30%)
C2H2 Zn finger 242..263 CDD:275368 9/22 (41%)
C2H2 Zn finger 271..292 CDD:275368 6/20 (30%)
C2H2 Zn finger 300..319 CDD:275368 7/17 (41%)
C2H2 Zn finger 330..347 CDD:275368
CG8944NP_573065.1 MADF_DNA_bdg 259..344 CDD:287510
MADF 379..472 CDD:214738
C2H2 Zn finger 476..496 CDD:275368 1/4 (25%)
C2H2 Zn finger 506..526 CDD:275368 5/19 (26%)
C2H2 Zn finger 537..557 CDD:275368 7/20 (35%)
C2H2 Zn finger 636..656 CDD:275368 7/19 (37%)
zf-C2H2_8 639..712 CDD:292531 22/73 (30%)
C2H2 Zn finger 666..688 CDD:275368 9/22 (41%)
zf-C2H2 694..716 CDD:278523 6/22 (27%)
C2H2 Zn finger 696..716 CDD:275368 6/20 (30%)
zf-H2C2_2 708..733 CDD:290200 7/25 (28%)
C2H2 Zn finger 724..744 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455509
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.